SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023648 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023648
Domain Number 1 Region: 16-284
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.68e-88
Family Eukaryotic proteases 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023648   Gene: ENSPPYG00000007309   Transcript: ENSPPYT00000032914
Sequence length 343
Comment pep:known chromosome:PPYG2:16:29667986:29671754:-1 gene:ENSPPYG00000007309 transcript:ENSPPYT00000032914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKGVLGPGQLVAVAILLYLGLLGSGTGAEGAEAACGVAPQARITGGSSADAGQWPWQV
SITHEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEEYEVKLGAHQLDSYSEDAKVSTLKDI
IPHPSYLQEGSQGDIALLQLSSPVNFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSV
SLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGG
PLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKATGLQPRVVPQTQESQ
PDSNLCGSRLAFSSAPAQGLLRPILFLPLGLALGLLSPWLSEH
Download sequence
Identical sequences K7ESY0
ENSPPYP00000023648 ENSPPYP00000023648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]