SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023754 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023754
Domain Number 1 Region: 3-335
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4e-114
Family Transferrin 0.000000235
Further Details:      
 
Domain Number 2 Region: 344-684
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.84e-112
Family Transferrin 0.000000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023754   Gene: ENSPPYG00000014453   Transcript: ENSPPYT00000033018
Sequence length 713
Comment pep:known_by_projection chromosome:PPYG2:3:201027527:201056103:-1 gene:ENSPPYG00000014453 transcript:ENSPPYT00000033018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVRWCATSDPEQHKCSNMSKAFQEAGIQPSLLCVQGTSADHCVQLIAAQEADAITLDGG
TVYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHVTIDTLKGVKSCHTGINRTVGW
NVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETGYSESLCRLCRGDSSGEGVCD
KSPQERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGKTLPSWGQALLSQDFELLCRDG
SRADVTEWRQCHLARVPAHAVVVRADTDGGLIFRLLNEGQRLFSHEGSSFQMFSSEAYGQ
KDLLFKDSTSELVPIATQTYEAWLGHEYLHAMKGLLCDPNRLPPYLRWCVLSTPEIQKCG
DMAVAFRRQQLKPEIQCVSAKSPQHCMEQIQAGHIDAVTLSGEDIYTAGKTYGLVPAAGE
HYAPEDSSNSYYVVAVVRRDSSDAFTLDELRGKCSCHAGFGSPAGWDIPVGALIRRGFIR
PKDCDVLTAVSEFFNASCVPVNNPENYPSSLCALCVGDEQGRNKCVGNSQERYYGYSGAF
RCLVENAGDVAFVRHTTVFDNTNGHNSEPWAAELRSEDYELLCPNGARAEVSQFAACNLA
QIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNYHGQDLLFKDATVRA
VPVGEKTTYRDWLGLDYVAALEGMLSQQCSGAGRTGPPCRLPWCHSDPFTPER
Download sequence
Identical sequences K7ET85
ENSPPYP00000023754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]