SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023939 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023939
Domain Number 1 Region: 209-466
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.79e-66
Family Eukaryotic proteases 0.00000000108
Further Details:      
 
Domain Number 2 Region: 143-213
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000594
Family Complement control module/SCR domain 0.0000149
Further Details:      
 
Domain Number 3 Region: 82-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000054
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 5-73
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000017
Family Spermadhesin, CUB domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023939   Gene: ENSPPYG00000029490   Transcript: ENSPPYT00000033203
Sequence length 472
Comment pep:novel chromosome:PPYG2:12_random:161095:167936:1 gene:ENSPPYG00000029490 transcript:ENSPPYT00000033203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQREDCDMEAADSEGNCLDSLVFVAGDQQFGPYCGHGFPGPLNIETKSNTLDIIFQTDL
TGQKKGWKLCYHADPMPCPKEDTPNSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATS
FYSTCQSNGKWSNSKLKCQPVDCGIPESIENGKVEDPESTLFGSVIRYTCEEPYYYTENG
GGGEYHCAGNGSWVNEVLGPELPKCVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFD
NPWAGGALIDEYWLLTAAHVVEGNREPTMYVGSTSVQTSWLAKSKMLTPEHVFIHLGWKL
LEVPEGRTNFDNDIALVRLKDPVKMGPTVSPICLPGTSSDYNLVDGDLGLISGWGRTEKR
GRAVRLKAARLPEALLRKCKEVKVEKPTADAEAYVFTPNMICAGGEKGMDSCKGDSGGAF
AVQDPNDKTKFYVAGLVSRGPQCRTYGLYTWVKNYIDWIMKTMQENSTPRED
Download sequence
Identical sequences K7ETR6
ENSPPYP00000023939 ENSPPYP00000023939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]