SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024075 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024075
Domain Number 1 Region: 153-211
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000323
Family TNF receptor-like 0.0026
Further Details:      
 
Domain Number 2 Region: 88-130
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000118
Family TNF receptor-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024075   Gene: ENSPPYG00000029489   Transcript: ENSPPYT00000033338
Sequence length 342
Comment pep:novel chromosome:PPYG2:20:62096303:62133789:1 gene:ENSPPYG00000029489 transcript:ENSPPYT00000033338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGTWAAPRQADWGQRRRHVGQAQQGPVSALSRALPAPVRTMRALEGPGLSLLCLVLAL
PALLLVPAVRGVAEAPTYPWRDAETGEWLVCAQCPPGTFVQRPCRRDSPTTCGPCPPRHY
TQFWNYLERCRYCNVLCGEREEEARACHATHNRACRCRAGFFAHAGFCLEHASCPPGTGV
IAPGTSSQNTQCQPCPPGTFSASSSSSEQCQPHRNCTALGLALNVPGSSSHDTLCTSCTG
FPLSTRAPGAEECERAVIDFVAFQDISIKRLQRLLQALEAPDGWGPTPRAGRTALQLKLR
RRLTELLEARDGALLARLLQALRVARMPGLERSVRERFLPVQ
Download sequence
Identical sequences K7EU51
ENSPPYP00000024075 ENSPPYP00000024075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]