SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024306 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024306
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily LEM domain 5.1e-23
Family LEM domain 0.000057
Further Details:      
 
Domain Number 2 Region: 107-155
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000000327
Family LEM domain 0.0000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024306   Gene: ENSPPYG00000004857   Transcript: ENSPPYT00000033568
Sequence length 345
Comment pep:known_by_projection chromosome:PPYG2:12:99767352:99803929:1 gene:ENSPPYG00000004857 transcript:ENSPPYT00000033568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGTNSK
GPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQDDKDDLDVTELTNEDL
LDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDS
DRYSDNEEDSKIELKLEKREPLKGRAKTPVTLKQRRVEHNQVGEKTEERRVERDILKEMF
PYEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGR
SIPVWIKILLFVVVAVFLFLVYQAMETNQVNPFSHFLHVDPRKSN
Download sequence
Identical sequences K7EUS9
ENSPPYP00000024306 XP_003778145.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]