SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024332 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024332
Domain Number 1 Region: 7-237
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.46e-78
Family Calponin-homology domain, CH-domain 0.0000937
Further Details:      
 
Domain Number 2 Region: 1305-1417
Classification Level Classification E-value
Superfamily E set domains 2.14e-35
Family Filamin repeat (rod domain) 0.00000262
Further Details:      
 
Domain Number 3 Region: 1399-1516
Classification Level Classification E-value
Superfamily E set domains 3.69e-35
Family Filamin repeat (rod domain) 0.00000377
Further Details:      
 
Domain Number 4 Region: 1216-1327
Classification Level Classification E-value
Superfamily E set domains 1.33e-31
Family Filamin repeat (rod domain) 0.00000088
Further Details:      
 
Domain Number 5 Region: 1592-1707
Classification Level Classification E-value
Superfamily E set domains 2.67e-30
Family Filamin repeat (rod domain) 0.00000426
Further Details:      
 
Domain Number 6 Region: 1038-1127
Classification Level Classification E-value
Superfamily E set domains 4.2e-30
Family Filamin repeat (rod domain) 0.00000348
Further Details:      
 
Domain Number 7 Region: 430-547
Classification Level Classification E-value
Superfamily E set domains 5.43e-30
Family Filamin repeat (rod domain) 0.00065
Further Details:      
 
Domain Number 8 Region: 1505-1610
Classification Level Classification E-value
Superfamily E set domains 1.96e-29
Family Filamin repeat (rod domain) 0.0000254
Further Details:      
 
Domain Number 9 Region: 720-843
Classification Level Classification E-value
Superfamily E set domains 4.27e-29
Family Filamin repeat (rod domain) 0.00087
Further Details:      
 
Domain Number 10 Region: 1817-1912
Classification Level Classification E-value
Superfamily E set domains 1.93e-28
Family Filamin repeat (rod domain) 0.0000128
Further Details:      
 
Domain Number 11 Region: 823-943
Classification Level Classification E-value
Superfamily E set domains 4.6e-28
Family Filamin repeat (rod domain) 0.00044
Further Details:      
 
Domain Number 12 Region: 252-365
Classification Level Classification E-value
Superfamily E set domains 2.6e-27
Family Filamin repeat (rod domain) 0.00085
Further Details:      
 
Domain Number 13 Region: 643-752
Classification Level Classification E-value
Superfamily E set domains 2.8e-27
Family Filamin repeat (rod domain) 0.00075
Further Details:      
 
Domain Number 14 Region: 2188-2283
Classification Level Classification E-value
Superfamily E set domains 5.74e-27
Family Filamin repeat (rod domain) 0.00000992
Further Details:      
 
Domain Number 15 Region: 1998-2093
Classification Level Classification E-value
Superfamily E set domains 1.6e-26
Family Filamin repeat (rod domain) 0.00000323
Further Details:      
 
Domain Number 16 Region: 1130-1239
Classification Level Classification E-value
Superfamily E set domains 2.67e-25
Family Filamin repeat (rod domain) 0.00000324
Further Details:      
 
Domain Number 17 Region: 2382-2474
Classification Level Classification E-value
Superfamily E set domains 1.07e-24
Family Filamin repeat (rod domain) 0.0000174
Further Details:      
 
Domain Number 18 Region: 2289-2380
Classification Level Classification E-value
Superfamily E set domains 5.4e-24
Family Filamin repeat (rod domain) 0.0000166
Further Details:      
 
Domain Number 19 Region: 352-448
Classification Level Classification E-value
Superfamily E set domains 5.98e-24
Family Filamin repeat (rod domain) 0.00094
Further Details:      
 
Domain Number 20 Region: 542-639
Classification Level Classification E-value
Superfamily E set domains 1.87e-23
Family Filamin repeat (rod domain) 0.00021
Further Details:      
 
Domain Number 21 Region: 951-1052
Classification Level Classification E-value
Superfamily E set domains 1.34e-21
Family Filamin repeat (rod domain) 0.00092
Further Details:      
 
Domain Number 22 Region: 2110-2205
Classification Level Classification E-value
Superfamily E set domains 7.34e-21
Family Filamin repeat (rod domain) 0.00001
Further Details:      
 
Domain Number 23 Region: 1908-1996
Classification Level Classification E-value
Superfamily E set domains 5.67e-18
Family Filamin repeat (rod domain) 0.00000529
Further Details:      
 
Domain Number 24 Region: 1755-1831
Classification Level Classification E-value
Superfamily E set domains 3.47e-16
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024332   Gene: ENSPPYG00000013765   Transcript: ENSPPYT00000033594
Sequence length 2501
Comment pep:known_by_projection chromosome:PPYG2:3:88047191:88211774:-1 gene:ENSPPYG00000013765 transcript:ENSPPYT00000033594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLEAAGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
MQPGPHVVKVFFAGDTIPKSPFIVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTK
AAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVRAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGK
DQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRESSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDLGTKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPTRVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQE
GKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDNIPLSPYRIRATQTGDASKCLAT
GPGIASTVKTSEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMN
GLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKL
GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESIT
RTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQ
EMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTRE
AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPV
IAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGITG
IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPN
HIAGSPFKAKVTGNDQPSSELLSLPGELVCQINHSGNYGWF
Download sequence
Identical sequences K7EUV5
ENSPPYP00000024332 XP_009237134.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]