SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024365 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024365
Domain Number 1 Region: 7-146
Classification Level Classification E-value
Superfamily C-type lectin-like 1.59e-31
Family C-type lectin domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024365   Gene: ENSPPYG00000029453   Transcript: ENSPPYT00000033628
Sequence length 156
Comment pep:novel chromosome:PPYG2:21_random:3837103:3840839:1 gene:ENSPPYG00000029453 transcript:ENSPPYT00000033628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWI
GLWRNGDGQTSGACPDLYQWSDGSNSQYRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPY
LYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTN
Download sequence
Identical sequences K7EUY8
ENSPPYP00000024365 ENSPPYP00000024365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]