SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024516 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024516
Domain Number 1 Region: 13-172
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.57e-57
Family Carbonic anhydrase 0.000000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024516   Gene: ENSPPYG00000029609   Transcript: ENSPPYT00000033779
Sequence length 178
Comment pep:novel chromosome:PPYG2:8_random:954455:960473:1 gene:ENSPPYG00000029609 transcript:ENSPPYT00000033779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FDKALILHVFVLVGPEQWSKLYPIANGNNQSPVDIKTSEAKHDTSLKPVSVSYNPATAKE
IINVGHSFHVNFEDNDNRSVLKGGPLSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAEL
HIVHWNSAKYSSLAEAVSKAGGLAVIGVLMKVGEANPKLQKVLDALQAIKTKVSTLHK
Download sequence
Identical sequences K7EVD4
ENSPPYP00000024516 ENSPPYP00000024516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]