SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024653 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024653
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.85e-20
Family Eukaryotic proteases 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024653   Gene: ENSPPYG00000029446   Transcript: ENSPPYT00000033915
Sequence length 149
Comment pep:novel chromosome:PPYG2:8:9414159:9416503:1 gene:ENSPPYG00000029446 transcript:ENSPPYT00000033915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVVNVTVVMGTRTFSNIHSERKQVQKVITHKDYKPPQLDSDLSLLLLATPVQFSNFKMP
VCLQEEERTWDRCWMAEWVTTNGYDQYDDLNMHLEKLRVVQISRKECAKRVNQLSRNMIC
AWKEPGTNGICKVLTPAQPPPPSRYPITF
Download sequence
Identical sequences K7EVR7
ENSPPYP00000024653 ENSPPYP00000024653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]