SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024769 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024769
Domain Number 1 Region: 67-290
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.62e-55
Family C-terminal domain of adrenodoxin reductase-like 0.00000000425
Further Details:      
 
Domain Number 2 Region: 260-418
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000000341
Family N-terminal domain of adrenodoxin reductase-like 0.000000628
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000024769
Domain Number - Region: 38-62
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00143
Family FAD/NAD-linked reductases, N-terminal and central domains 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024769   Gene: ENSPPYG00000008607   Transcript: ENSPPYT00000034036
Sequence length 419
Comment pep:known_by_projection chromosome:PPYG2:17:64863444:64874450:-1 gene:ENSPPYG00000008607 transcript:ENSPPYT00000034036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRCWRWWGLSAWPRTRLPPAGSTPSFRHHFSTQEKTPQICVVGSGPAGFYTAQHLLKS
YGAEDHRALEIPGEELPGVFSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVA
RILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGARP
ILDPADFLGLQDKIKEVPRPRKRLTELLFRTATEKPGPEEAVRQASASRAWGLRFFRSPQ
QVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDIEDLPCGLVLSSIGYKSRPVDPSVP
FDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQMLLQDLKAGLLPS
GPRPGYAAIQALLSSRGVQPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEMLRLLGH
Download sequence
Identical sequences K7EW30
ENSPPYP00000024769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]