SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000468 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000468
Domain Number 1 Region: 887-1018,1081-1147
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.49e-38
Family Hemopexin-like domain 0.00092
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000196
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000144
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000468   Gene: ENSPPYG00000000412   Transcript: ENSPPYT00000000488
Sequence length 1147
Comment pep:known_by_projection chromosome:PPYG2:1:64239800:64256806:-1 gene:ENSPPYG00000000412 transcript:ENSPPYT00000000488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWKTLPIYLLLLLSVFVIQQVSSQDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDF
KRVCTVELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAP
PPSGASQTIKSTTKRSPKPPNKKKTKKVVESEEITEEHSVSENQESSSSSSSSSSSSSTI
RKIKSSKNSAANRELQKKLKVKDNKKNRTKKKPTPKPPVVDEAGSGLDNGDFKVTTPDMS
TTQHNKVTTSPKITTAKPINPRPSLPPNSDTSKETSLTANKETTKPAPTTPKEPAPTTPK
EPAPTTPKKPASTTPKEPAPATTKSALTTPKEPAPTTPKEPAPTTPEKLTPTTPEKLAPT
TPEEPAPTTSEEPAPTTPEEPAPTTPEEPAPTTPEEPAPTTPEEPAPTTPKAPAPTTPKE
PVPTTPKETAPTTPKEPAPTTPKETAPTTPKETAPTTPKETAPTTPKEPAPTTPKEPAPT
TPKEPVPTTPKETAPTTPKESAPTTPKGTAPTTPKGTAPTTPKETAPTTLKEPAPTVPKK
PAPKELAPTTTKEPTSTTSDKPAPTTPKETISTTPKEPAPTTPKKPAPTTPVTPPPTDSE
VSTPTTTKEPPTSHKSPDESTPELSAEPTPKALENSPKEPGVPTTKTPTVTKPEMTTIAK
DKTTERDIRTTPETTTAAPKMTKETATTTEKTTESKIATTTTQVTSTTTQDTTPFKITTL
KTTTLAPKVTTTKKTITTTEIMNKPKETANPKDRATISQARTLKPQKPTKAPKKPTSTKK
PKTTPRVRKPKTTPTPRKMTSTMPELNPTSRVEAMLQTTTRPNQTPNSKLVEVNPKNEDA
GGAEGETPHMLPRPHVFMPEVTPDMAYLPRVPNQRIIINPMLSDETNICNGKPVDGLTTL
RNGTLVAFRGHYFWMLSPFSPPSPARRITEVWGIPSPIDTVFTRCNCEGKTFFFKDSQYW
RFTNDIKDAGYPKPIFKGFGGLTGQIVAALSTAKYKNWPESVYFFKRGGSIQQYIYKQEP
VQKCPGRRPALNYPVYGETTQVRRRRFERAIGPSQTHTIRIHYSPTRLAYQDKGVLHNEV
KVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLS
KVWYNCP
Download sequence
Identical sequences H2N4D7
ENSPPYP00000000468 ENSPPYP00000000468 9600.ENSPPYP00000000468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]