SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002451 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002451
Domain Number 1 Region: 278-477
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.48e-91
Family N-myristoyl transferase, NMT 0.0000000256
Further Details:      
 
Domain Number 2 Region: 96-277
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.17e-79
Family N-myristoyl transferase, NMT 0.000000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002451   Gene: ENSPPYG00000002114   Transcript: ENSPPYT00000002526
Sequence length 478
Comment pep:known_by_projection chromosome:PPYG2:10:15789402:15822659:-1 gene:ENSPPYG00000002114 transcript:ENSPPYT00000002526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAEVLEGIWEPKRKRRNRREKRRNQIPEAPSQTRHLIPRRLKFSSLRNTTPSGSRFQREQ
PWNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQFWDTQPVPKLDEVITSHGAI
EPDKDNVRQEPYSLPQGFMWDTLDLSSAEVLKELYTLLNENYVEDDDNMFRFDYSPEFLL
WALRPPGWLLQWHCGVRVSSNKKLVGFISAIPANIRIYDSVKKMVEINFLCVHKKLRSKR
VAPVLIREITRRVNLEGIFQAVYTAGVVLPKPVATCRYWHRSLNPRKLVEVKFSHLSRNM
TLQRTMKLYRLPDVTKTSGLRPMEPKDIKSVRELINTYLKQFHLAPVMDEEEVAHWFLPR
EHIIDTFVVESPNGKLTDFLSFYTLPSTVMHHPAHKSLKAAYSFYNIHTETPLLDLMSDA
LILAKSKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDSEKVGLVLQ
Download sequence
Identical sequences H2N9U4
ENSPPYP00000002451 9600.ENSPPYP00000002451 ENSPPYP00000002451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]