SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002692 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002692
Domain Number 1 Region: 427-695
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.73e-108
Family N-acetyl transferase, NAT 0.00000000101
Further Details:      
 
Domain Number 2 Region: 256-327
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.17e-17
Family PHD domain 0.005
Further Details:      
 
Domain Number 3 Region: 101-180
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000707
Family Linker histone H1/H5 0.025
Further Details:      
 
Domain Number 4 Region: 769-819
Classification Level Classification E-value
Superfamily ARM repeat 0.0000472
Family GUN4-associated domain 0.083
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000002692
Domain Number - Region: 202-270
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000687
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002692   Gene: ENSPPYG00000002318   Transcript: ENSPPYT00000002783
Sequence length 1785
Comment pep:known_by_projection chromosome:PPYG2:10:60127131:60340474:-1 gene:ENSPPYG00000002318 transcript:ENSPPYT00000002783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSTKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLD
GKGAPQYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRVQGRNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDE
GSMNAFTGRGSPDTEIKINIKQESADVNVIGNKDVVTEEDLDVFKQAQELSWEKIECESG
VEDCGRYPSVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCG
WFHPPANEIYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKN
DEKGCHLVGYFSNEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEK
PLSDLGRLSYLAYWKSVILEYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRD
GRFVIIRREKLILSHMEKLKTCSRANELDPDSLRWTPILISNAAVSEEEREAEKEAERLM
EQASCWEKEEQEILSTRANSRQSPAKVQSKNKYLHSPESRPVTGERGQLLELSKESSEEE
EEEDEEEEEEEEEEEEEDEEEEEEEEEEEEEEEEEEEENIQSSPPRLTKPQSVAIKRKRP
FVLKKKRGRKRRRINSSVTTETISETTEVLNEPFDNSDEERPMPQLEPTCEIEVEEDGRK
PVLRKAFQHQPGKKRQTEEEEGKDNHCFKNADPCRNNMNDDSSNLKEGSKDNPEPLKCKQ
VWPKGTKRGLSKWRQNKERKTGFKLNLYTPPETPMEPDEQVTVEEQKETSEGKTSPSPIR
IEEEVKETGEALLPQEENRREETCAPVSPNTSPGEKPEDDLIKPEEEEEEEEEEEEEEEG
EEEEEEGGNVEKDPDGAKSQEKEEPEISTEKEDSARLDDHEEEEEEDEEPSHNEDHDADD
EDDSHMESAEVEKEELPRESFKEVLENQEAFLDLNVQPGHSNPEVLMDCGVDLTASCNSE
PKELAGDPEAVPESDEEPPPGEQAQKQDQKNSKEVDTEFKEGNPATMEIDSETVQAVQSL
TQESSEQDDTFQDCAETQEACRSLQNYTRADQSPQIATTLDDCQQSDHSSPVSSVHSHPG
QSVRSVNSPSVPALENSYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFS
DLGSIESTTENYENPSSYDSTMGGSICGNGSSQNSCSYSNLTSSSLTQSSCAVTQQMSNI
SGSCSMLQQTSISSPPTCSVKSPQGCVVERPPSSSQQLAQCSMAANFTPPMQLAEIPETG
NANIGLYERMGQSDFGAGHYPQPSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANSAS
LSTPLSNTGLVQLSQSPHSVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMAASNIGIS
HSQRLQTQIASKGHVSMRTKSASLSPAAATHQSQIYGRSQTVAMQGPARTLTMQRGMNMS
VNLMPAPAYNVNSVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMM
GTQPYAQQPMQTPPHGNMMYTAPGHHGYMNTGMSKQSLNGSYMRR
Download sequence
Identical sequences H2NAI1
ENSPPYP00000002692 ENSPPYP00000002692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]