SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002809 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002809
Domain Number 1 Region: 434-827
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.38e-132
Family Ankyrin repeat 0.000000000188
Further Details:      
 
Domain Number 2 Region: 197-452
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.32e-73
Family Ankyrin repeat 0.00000265
Further Details:      
 
Domain Number 3 Region: 47-257
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.13e-54
Family Ankyrin repeat 0.000014
Further Details:      
 
Domain Number 4 Region: 3981-4091
Classification Level Classification E-value
Superfamily DEATH domain 9.13e-26
Family DEATH domain, DD 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002809   Gene: ENSPPYG00000002423   Transcript: ENSPPYT00000002908
Sequence length 4275
Comment pep:known_by_projection chromosome:PPYG2:10:75399799:75782486:1 gene:ENSPPYG00000002423 transcript:ENSPPYT00000002908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHAASQLKKNRDLEINAEEEPEKKRKHRKRSRDRKKKSDANASYLRAARAGHLEKALDY
IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQA
EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVA
LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLH
IAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD
GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPV
DDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL
KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAE
VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSA
REGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLT
PLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAV
TRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG
AHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIIN
VLLQNNASPNELTVNGNTALGIARRLGYISVVDTLKIVTEETMTTTTVTEKHKMNVPETM
NEVLDMSDDEVRKANAPEMLSDGEYISDVEEGEDAMTGDTDKYLGPQDLKELGDDSLPAE
GYMGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSL
RHYSWAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRI
TCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVL
RSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRI
KQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFS
PIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDI
TGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKM
NDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGG
QQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHK
KETESDQDDEIEKTDRRQSFASLALRKRYSYLTEPGMIERSTGATRSLPTTYSYKPFFST
RPYQSWTTAPITVPGPAKSGFTSLSSSSSNTPSASPLKSIWSVSTPSPIKSTLGASTTSS
VKSISDVASPIRSFRTMSSPIKTVVSQSPYNIQVSSGTLARVPAVTEATPLKGLASNSTF
SSRTSPVTTAGSLLERSSITMTPPASPKSNINMYSSSLPFKSIITSAAPLISSPLKSVVS
PVKSAVDVISSAKVTMASSLSSPVKQMPGHAEVALVNGSISPLKYPSSSTLINGCKATAT
LQEKISSATNSVSSVVNAATDTVEKVFSTTTAMPFSPLRSYVSAAPSAFQSLRTPSASAL
YTSLGSSISATTSSVTSSIITVPVYSVVNVLPEPALKKLPDSNSFTKSAAALLSPIKTLT
TETHPQPHFSRTSSPVKSSLFLAPSALKLSTPSSLSSSQEILKDVAEMKEDLMRMTAILQ
TDVPEEKPFQPELPKEGRIDDEEPFKIVEKVKEDLVKVSEILKKDVCVDNKGSPKSPKSD
KGHSPEDDWVEFSSEEIREARQQAAASHSPSLPERVQVKAKAASEKDYNLTKVIDYLTND
IGSSSLTNLKYKFEDAKKDGEERQKRVLKPAIALQEHKLKMPPASMRPSTSEKELCKMAD
SFFGTDTILESPDDFSQHDQDKSPLSDSGFETRSEKTPSAPQSAESTGPKPLFHEVPIPP
VITETRTEVVNVIRSYEPSAGDVPQTQAGLFEHKSAVSPDVHKSAAETSAQHAEKDNQMK
PKLERIIEVHIEKGNQAEPTEVIIRETKKHPEKEMYVYQKDLSRGDINLKDFLPEKHDAF
PCSEEQGQQEEEELTAEESLPSYLESSRVNTPVSQEEDSRPSSAQLISDDSYKTLKLLSQ
HSIEYHDDELSELRGESYRFAEKMLLSEKLDVSHSDTEESVTDHAGPPSSELQGSDKRSR
EKIATAPKKEILSKIYKDVSENGVGKVSKDEHFDKVTVLHYSGNVSSPKHAMWMRFTEDR
LDRGREKLIYEDRVDRTVKEAEEKLTEVSQFFRDKTEKLNDELQSPEKKARPKNGKEYSS
QSPTSSSPEKVLLTELLASNDEWVKARQHGPDGQGFPKAEEKAPSLPSSPEKMVLSQQTE
DSKSTVEAEGSISQSKAPDGPQSGFQLKQSKLSSIRLKFEQGTHAKSKDMSQEDRKSDGQ
SRIPVKKIQESKLPVYQVFAREKQQKAIDLPDESVSVQKDFMVLKAKDEHAQSNEIVVND
SGSDNVKKQRTEMSSKAMPDSFSEQQAKDLACHITSDLATRGPWDKKVFRTWESSGATNN
KSQKEKLSHVLVHDVRENHVGHPEIKSVDQKNEFMSVTEREHKLLTNGSLSSEIKEMTVQ
SPSKKVLYREYVVKEGDHPGGLLDQPSRRSESSAVSHIPVRVADERRMLSSNIPDGFCEQ
SAFPKHELSQKLSQSSMSKETVETQHFNSIEDEKVTYSEISKVSKHQSYVGLCPPLEETE
TSPTKSPDSLEFSPGKESPSSDVFDHSPIDGLEKLAPLAQTEGGKEIKTLPVYVSFVQVG
KQYEKEIQQGSVKKIISQECKTVQETRGTFYTTRQQKQPPSPQGSPEDDTLEQVSFLDSS
GKSPLTPETPSSEEVSYEFTSKTPDSLIAYIPGKPSPIPEVSEESEEEEQAKSASLKQTT
VEETAVEREMPNDVSKDSNQRPKNNRVAYIEFPPPPPLDADQIESDKKHHYLPEKEVDMI
EVNLQDEHDKYQLAEPVIRVQPPSPVPPGADVSDSSDDESIYQPVPVKKYTFKLKEVDNE
QKEKSKASAEKASNQKELESNGSGKDNEFGLGLDSPQNEIAQNGNNDQSITECSIATTAE
FSHDTDATEIDSLDGYDLQDEDDGLTESDSKLPVQAMEIKKDIWNTEGILKPADRSFSQS
KLEVIEEEGKVGPDEDKPPSKSSSSEKTPDKTDQKSGAQFFTLEGRHPDRSVFPDTYFSY
KVDEEFATPFKTVATKGLDFDPWSNNRGDDEVFDSKSREDETKPFGLAVEDRSPATTPDT
TPARTPTDESTPTSEPNPFPFHEGKMFEMTRSGAIDMSKRDFVEERLQFFQIGEHTSEGK
SGDQGEGDKSMVTATPQPQSGDTTVETNLERNVETPTVELNPSIPTSGECQEGTSSSGSL
EKSAAATNTSKVDPKLRTPIKMGISASTMTMKKEGPGEITDKIEAVMTSCQGLENETITM
ISNTANSQMGVRPHEKHDFQKDNFNNNNNLDSSTIQTDNIMSNTVLTEHSAPTCTTEKDN
PVKVSSGKKTGVLQGHCVRDKQKVLGEQQKTKELIGIRQKSKLPIKATSPKDTFPPNHMN
TKASKMKQVSQSEKTKALTTSSCVDVKSRIPVKNTHRDNIIAVRKACATQKQGQPEKGKA
KQLPSKLPVKVRSTCVTTTTTTTTTTATTTTTTTTTSCTVKVRKSQLKEVCKHSIEYFKG
ISGETLKLVDRLSEEDKKMQSELSDEEESTSRNTSLSETSRGGQPSVTTKSARDKKTEAA
PLKSKSEKAGSEKRSSRRTGPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQI
RVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISG
TRSFADENNVFHDPVDGWQNETSTGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSYLK
GEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQSTKETLKPKIHGSGHVEEPASPLAA
YQKSLEETSKLLIEETKPCVPVSMKKMSRTSPADGKPRLNLHEEEGSSGSEQKQGEGFKV
KTKKEIRHVEKKSHS
Download sequence
Identical sequences H2NAT9
9600.ENSPPYP00000002809 ENSPPYP00000002809 ENSPPYP00000002809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]