SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004862 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004862
Domain Number 1 Region: 80-222
Classification Level Classification E-value
Superfamily C-type lectin-like 6.65e-34
Family C-type lectin domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004862   Gene: ENSPPYG00000004263   Transcript: ENSPPYT00000005053
Sequence length 229
Comment pep:known_by_projection chromosome:PPYG2:12:10266636:10272596:-1 gene:ENSPPYG00000004263 transcript:ENSPPYT00000005053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDEDGYITLNIKTRKPALVSVGPASSSWWRVMALILLILCVGMVVGLVALGIWSVMQHN
YLQDENENRTGTLQQLAKRFCQYVIKQSELKGTFKGHKCSPCDTNWRYYGDSCYGFFRHN
LTWQESKQYCTDMNATLLKIDNQNIVEYIKARTSLIRWVGLSRQKSNEVWKWEDGSGISE
NMYEFLEDGKGNMNCAYFHNGKMHPTFCENRHYLMCERKAGMTKVDQLP
Download sequence
Identical sequences H2NGH1
XP_002822941.1.23681 ENSPPYP00000004862 ENSPPYP00000004862 9600.ENSPPYP00000004862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]