SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005105 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005105
Domain Number 1 Region: 35-147
Classification Level Classification E-value
Superfamily FKBP-like 8.25e-35
Family FKBP immunophilin/proline isomerase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005105   Gene: ENSPPYG00000004472   Transcript: ENSPPYT00000005306
Sequence length 201
Comment pep:known_by_projection chromosome:PPYG2:12:48577350:48582524:-1 gene:ENSPPYG00000004472 transcript:ENSPPYT00000005306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTL
HIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYG
KRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKA
NRPKVSKKKLKEEKRNKSKKK
Download sequence
Identical sequences H2NH58 Q9NYL4
ENSP00000449751 ENSP00000449751 ENSPPYP00000005105 NP_057678.1.87134 NP_057678.1.92137 XP_002823215.1.23681 ENSP00000256680 gi|7706131|ref|NP_057678.1| ENSPPYP00000005105 9600.ENSPPYP00000005105 9606.ENSP00000256680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]