SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006603 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006603
Domain Number 1 Region: 26-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.92e-27
Family PDI-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006603   Gene: ENSPPYG00000005810   Transcript: ENSPPYT00000006865
Sequence length 280
Comment pep:known chromosome:PPYG2:14:51690839:51706013:1 gene:ENSPPYG00000005810 transcript:ENSPPYT00000006865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSGSLAVPLAVLVLLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIEFYAPWCPACQ
NLQPEWESFAEWGEDLEVNVAKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTK
KDFINFISDKEWKSIEPVSSWFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGS
YTVFALATLFSGLLLGLCMIFVADCLCPSKRRRPQPYPHPSKKLLSESAQPLKKVEEEQE
ADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLAADKS
Download sequence
Identical sequences H2NL86
9600.ENSPPYP00000006603 ENSPPYP00000006603 ENSPPYP00000006603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]