SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009343 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009343
Domain Number 1 Region: 317-516
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.13e-92
Family N-myristoyl transferase, NMT 0.00000000419
Further Details:      
 
Domain Number 2 Region: 136-316
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.72e-78
Family N-myristoyl transferase, NMT 0.000000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009343   Gene: ENSPPYG00000008314   Transcript: ENSPPYT00000009720
Sequence length 517
Comment pep:known chromosome:PPYG2:17:44320634:44371137:-1 gene:ENSPPYG00000008314 transcript:ENSPPYT00000009720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSDGTPHVAGRGALLSQLKMADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDN
SYNRGGLSPANDTGAKKKKKKQKKKKEKGSETDSAQDQPVKMNSLPAERIQEIQKAIELF
SVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWD
ALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRVVSS
RKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQA
VYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLR
PMETKDIPVVHQLLTRYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLS
FYTLPSTIMNHPTHKSLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENK
TFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ
Download sequence
Identical sequences H2NTR8
ENSPPYP00000009343 ENSPPYP00000009343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]