SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009683 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009683
Domain Number 1 Region: 43-242
Classification Level Classification E-value
Superfamily Ribosomal protein S7 1.44e-48
Family Ribosomal protein S7 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009683   Gene: ENSPPYG00000008623   Transcript: ENSPPYT00000010068
Sequence length 250
Comment pep:known_by_projection chromosome:PPYG2:17:65259454:65265613:1 gene:ENSPPYG00000008623 transcript:ENSPPYT00000010068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSWPAKMAAPAVKVARGWLGLALGVRPAVLQLPGLTQVRWSRYNPEFKDPLIDKEYYR
KSVEELTEEEKYDRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMT
QTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVPV
PLPDRRRRFLAMKWMITECRDRKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDMHKMAEA
NRALAHYRWW
Download sequence
Identical sequences H2NUP6
XP_002827876.1.23681 ENSPPYP00000009683 ENSPPYP00000009683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]