SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010961 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010961
Domain Number 1 Region: 461-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.68e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 237-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.24e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 545-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.7e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 7 Region: 587-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000435
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000255
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 10 Region: 508-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000263
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 11 Region: 284-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000407
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 384-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000154
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010961   Gene: ENSPPYG00000009785   Transcript: ENSPPYT00000011388
Sequence length 674
Comment pep:known_by_projection chromosome:PPYG2:19:21117417:21153556:1 gene:ENSPPYG00000009785 transcript:ENSPPYT00000011388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLTFTDVAIEFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAVSKPDLITCLEKEK
ESCNMKRHEMVDEPPVVCSHFAEDFWPEQDIKDSFQKVTLRRYDKRGHENLQLRKGYKTV
GDCKLYKGGYNGLNQCLTLTQSKMYHCDIYVKVFYAFSNADRYKTRHTGKKPFQCKKCGK
SFCMLSQLTQHKKIHIRENTYRCKEFGNAFNQSSALTNHKRIYIGEKHYRCVECDKAFNH
YSTLTNHKRIHTGEKPYKCKECGKAFSRYSTLTTHKRIHSGEKPYKCDECGKTFSISSTF
TKHKIIHTEEKPYKCKECGKAFNRSSTLTSHKRIHTGEKPYKCEECGKAFNWSSTLTKHK
VIHTGEKPYKCEECGKAFNQSSRLTRHKKIHTGEKPYKFEECGRVFTCSSTLTQDKKIHT
GEKPYNCEECGKVFTYSSTLTRHKRIHTEEKPYKCNECGKAFNRSSHLTSHRRIHTGEKP
YKCEECGKAFKQSSNLNSHKKIHTGEKPYKCEECGKAFILSSRLTQHKKIHTGEKPYKCE
ECGKAFNRSSRLTQHKKIHTGEKPYKCEQCDKAFTHSSNLSSHKKIHTGEKPYKCEECGK
AFNRSSRLTQHKKIHTREKPYKCEECAKAFTRSSRLTQHKKIHRLGVVSHACNPTTLGGR
GGRITRSGDRDRPG
Download sequence
Identical sequences H2NY82
ENSPPYP00000010961 ENSPPYP00000010961 XP_002829038.1.23681 9600.ENSPPYP00000010961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]