SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011286 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011286
Domain Number 1 Region: 562-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 618-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 674-730
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 506-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.61e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 827-879
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.34e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.85e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 7 Region: 786-842
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-21
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 8 Region: 730-786
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.42e-21
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 9 Region: 395-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000781
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 10 Region: 315-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000151
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 11 Region: 256-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000173
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 12 Region: 452-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000548
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011286   Gene: ENSPPYG00000010087   Transcript: ENSPPYT00000011726
Sequence length 913
Comment pep:known_by_projection chromosome:PPYG2:19:45551039:45582982:-1 gene:ENSPPYG00000010087 transcript:ENSPPYT00000011726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKFQEMVTFKDVAVVFTEEELGLLDSVQRKLYRDVMLENFRNLLLVAHQPFKPDLISQL
EREEKLLMVETETPRDGCSGRKNQQKMESIQEVTVSYLSPRELSSRQTWQQSAGGLIRCQ
DFLKVFQGKNSQLEEQGNSLCQVWAGIPVQISEDENYILTHIGNGSNYIKSQEYPSWREH
HSWRKMYLKESHNYQCRCQQISTKNNLCKCDSVSWLLHHNGKLEVHRKENYSCHDCGEDI
MKVSLLNQDSIQTEEKPYPCTGYRKAFGNDSSSEVHQQFHLEGKPYTYSSCGKGCSYSSL
LHIHQNIEREDDIENSHLKSYQRVHTEEKRCKCGEYGENFNHCSPLNSYELIHTGEMSYR
RNIYEKAFSHNLDLNSIFRVHTRDEPHEYEENENVFNQSSCLQVHQKIHTEEKLYTDIEY
GKSFISSSNLDIQHRVHMEENSCNSEECGNGFSLASHFQDLQIVHTKEQPYKRYVCSNSF
SHNLYLQGHPKIHIGEKPRKECGNGFNWSSKLKDHQRVHTGQKPYKCNICGKGFNHRSVL
NVHQRVHTGEKPYKCEECDKGFSRSSYLQAHQRVHTGEKPYKCEECGKGFSRNSYLQGHQ
RVHTGEKPYKCEECGKGFSRSSHLQGHQRVHTGEKPFKCEECGKGFSWSFNLQIHQRVHT
GEKPYKCEECGKGFSKASTLLAHQRVHTGEKPYQCDECGKSFSQRSYLQSHQSVHSGERP
YVCEVCGKGFSQRAYLQGHQRVHTRVKPYKCEMCGKGFSQSSRLEAHRRVHTGGKPYKCE
VCTKGFSESSRLQAHQRVHAEGRPYKCEQCGKGFSGYSSLQAHHRVHTGEKPYKCEVCGK
GFSQRSNLQAHQRVHTGEKPYKCDACGKGFRWSSGLLIHQRVHSSDKFYKSEDYGKDYPS
SENLHRNEDSVLF
Download sequence
Identical sequences H2NZ52
ENSPPYP00000011286 ENSPPYP00000011286 XP_009231018.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]