SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014995 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014995
Domain Number 1 Region: 889-1100
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-40
Family DBL homology domain (DH-domain) 0.0022
Further Details:      
 
Domain Number 2 Region: 1259-1460
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-31
Family Pleckstrin-homology domain (PH domain) 0.0000886
Further Details:      
 
Domain Number 3 Region: 1090-1207
Classification Level Classification E-value
Superfamily PH domain-like 3.6e-23
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014995   Gene: ENSPPYG00000013407   Transcript: ENSPPYT00000015595
Sequence length 1462
Comment pep:known_by_projection chromosome:PPYG2:3:2327086:2442983:1 gene:ENSPPYG00000013407 transcript:ENSPPYT00000015595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRGPKPPIAPKPRLTAPNEWRASVVPEDSLNKCSNGRLLCVDRGLDEGPRSIPKCSESE
TDEDYIVVPRAPLREDEPKDRGSVGNKALMSPEASAEEEEEREEGGEACGLEGTGAGEDS
AAPAAPGAGALSREGEEGTDLIPEDEGEGCADEPGTLEQVSRSEEEEKLVQRHRECSLED
SGPWAGEGVFQSDLLLPHIHGEDHEPSDTPGEAEEDDEEGCASTDPAGADEGSGPDRPTE
DMGQDAEDTSEEPPEKEELAGVQEAETATDCPEVLEEGCEEATGVTGGEQVDLSEPPDHE
EKTNQEVAAATLEDRAQDESAEESCQIVPFENDCTEDFVTSLTGSPYEFFPTESTSFCSE
SCSLSESAKGFRIRGRAPKLGRHAEENPMVGASCGQCGSLQGGVAEGPTAPDVVVVLEEE
ALDDALANPYVMGVGLPGQAAPGEGGQAASDALGGYGSKEEMNCEAEGGVVPADRKNTST
RVRPHSGKVAGYVPETVPEETGPEAGSSAPGIGGATEEVGKTLLSLEGKPLEASLLGPCQ
QSPLLYTLRSFSVEGREIPVSVYQEPEGSGFDDHRKRKEDNLSLSCVIGSSGSFSQRNHL
PSSGTSTPSSMVDIPPPFDLACITQESPSQKSSPSLLIESDSLDKYKKKKSSFKRFLALT
FKKKTENKLHVDVNVSSSRSSSESSYHGPSRILEVDRRSLSNSPQLKSRTGKLRASESPS
SLIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPSADTSDYENIPAM
NSDYENIQIPPRRPARAGAFSKLFEDQSRALSTANENDGYVDMSSFNAFESKQQSADQDA
ESAYTEPYKVCPISSAAPKEDLTSDEEQRSSEEEDSASRDPSLTHKVEGQSRALVIAQEL
LSSEKAYVEMLQHLNLDFHGAVMRALDDMDHEGRDTLAREELRQGLSELPAIHDLHQGIL
EELEERLSNWESQQKVADIFLAREQGFDHHATHILQFDRYLGLLSENCLHSPRLAAAVRE
FEQSVQGGSQTAKHRLLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNTQGALSLISKVTDR
ANDSMEQGENLQKLVHIEHSVRGQGDLLQPGREFLKEGTLMKVTGKNRRPRHLFLMNDVL
LYTYPQKEGKYRLKNTLAVANMXVSRPVMEKVPYALKIETSESCLMLSASSCAERDEWYG
CLSRALPEDYKAQALAAFHHSVEIRERLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLR
RHHCHACGKIVCRNCSRNKYPLKYLKDRMAKVCDGCFGELKKRGRAVPGLMRERPVSMSF
PLSAPRFSGSAFSSVFQSINPSTFKKQKKVPSALTEVAASGEGSAISGYLSRCKRGKRHW
KKLWFVIKGKVLYTYMASEDKVAMESMPLLGFTIAPEKEEGSSEVGPIFHLYHKKTLFYS
FKAEDTNSAQRWIEAMEDASVL
Download sequence
Identical sequences H2P9C2
ENSPPYP00000014995 9600.ENSPPYP00000014995 ENSPPYP00000014995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]