SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015062 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015062
Domain Number 1 Region: 237-478
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 9.11e-58
Family Decarboxylase 0.000000446
Further Details:      
 
Domain Number 2 Region: 14-204
Classification Level Classification E-value
Superfamily PRTase-like 7.67e-44
Family Phosphoribosyltransferases (PRTases) 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015062   Gene: ENSPPYG00000013467   Transcript: ENSPPYT00000015664
Sequence length 480
Comment pep:known chromosome:PPYG2:3:7868058:7883379:-1 gene:ENSPPYG00000013467 transcript:ENSPPYT00000015664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVGAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADTLFQT
AQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCL
IIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKML
EILEQQKKIDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFSARAELPRIHPVA
SKLLRLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMKELIT
LAKRHEFLIFEDRKFADIGNTVKKQYEGGVFKIASWADLVNAHVVPGSGVVKGLQEVGLP
LHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ
LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADCLEAAEMYRKAAWEAYLSRLGV
Download sequence
Identical sequences H2P9I4
9600.ENSPPYP00000015062 ENSPPYP00000015062 ENSPPYP00000015062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]