SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015096 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015096
Domain Number 1 Region: 2069-2261,2314-2497,2531-2586
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 9.01e-112
Family DNA polymerase I 0.000000937
Further Details:      
 
Domain Number 2 Region: 103-271,304-359,409-497
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.26e-44
Family Tandem AAA-ATPase domain 0.00039
Further Details:      
 
Domain Number 3 Region: 661-834
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.07e-42
Family Achaeal helicase C-terminal domain 0.0014
Further Details:      
 
Domain Number 4 Region: 1900-2020
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000224
Family DnaQ-like 3'-5' exonuclease 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000015096
Domain Number - Region: 529-617
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0087
Family RecQ helicase DNA-binding domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015096   Gene: ENSPPYG00000013498   Transcript: ENSPPYT00000015699
Sequence length 2590
Comment pep:known_by_projection chromosome:PPYG2:3:11204235:11319406:1 gene:ENSPPYG00000013498 transcript:ENSPPYT00000015699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLLRRSGKRRRSESGSDSFSGSGGDSSASPQLLSGSVLSPPPGLGRCLKAVAAGECKPT
VPDYQIDKLLLANWGLPKAVLEKYHSFGVKKMFEWQAECLLLGQVLEGKNLVYSAPTSAG
KTLVAELLILKRVLEMQKKALFILPFVSVAKEKKYYLQSLFQEVGIKVDGYMGSTSPSRH
FSSLDIAVCTIERANGLINRLIEENKMDLLGMVVVDELHMLGDSHRGYLLELLLTKICYI
TWKSASCQADLASSVSNAVQIVGMSATLPNLELVASWLNAELYHTDFRPVPLLESVKVGN
SIYDSSMKLVREFEPMLQVKGDEDHVVSLCYETIRDNHSVLLFCPSKKWCEKLADIIARE
FYNLRHQAEGLVKPSECPPVILEQKELLEVMDQLRRLPSGLDSVLQKTIPWGVAFHHAGL
TFEERDIIEGAFRQGLIRVLAATSTLSSGVNLPARRVIIRTPIFGGRPLDILTYKQMVGR
AGRKGVDTVGESILICKNSEKSKGIALLQGSLKPVRSCLQRREGEEVTASMIRAILEIIV
GGVASTSQDMHTYAACTFLAASMKDGKQGIQRNQESVQLGAIEACVMWLLENEFIQSTEA
SDGTEGKVYHPTHLGSATLSSSLSPADTLDIFADLQRAMKGFVLENDLHILYLVTPMFED
WTTIDWYRFFCLWEKLPTSMKRVAELVGVEEGFLARCVKGKVVARTERQHRQMAIHKRFF
TSLVLLDLISEVPLREINQKYGCNRGQIQSLQQSAAVYAGMITVFSNRLGWHNMELLLSE
FQKRLTFGIQRELCDLVRVSLLNAQRARVLYASGFHTVADLARANIVEVEVILKNAVPFK
SARKAVDEEEEAVEERRNMRTIWVTGRKGLTEREAAALIVEEARMILQQDLVEMGVQWNP
CALLHSSTCSLTHSESEVKEHTFISQTKSSYKKLTSENKSNTIFSDSYIKHSPNIVQDLN
KSREHTSSFNCNFQNGNQEHQRCSIFRARKRASLDINKEKPGASQNEGKTSNKKVVQTFS
QKTKKAPLNFNSEKMSRSFRSWKHRKHLKRSRDSSTLKDSRACRIHLQGQTLSNPSICED
PFALDEKKMEFRNSGPFAKNVSLSGKEKDNKTSFPLQIKQNCSWNITLTNDNFVEHIVTR
SQSKNVTCQATNVVSEKGRGVAVEAEKINEVLIQNGSKHQNVYMKHHDTHPINKYPRKQS
HEQTSTFTKQKNIIERQMPCEAVSSYTNRDSNVTINCERIKLNTEENKPSHFQALGDDIS
RTAIPSEVLPSTGAFSKSGGQHENFLNISRLQEKTGTYTTNKTKNNHVSDLGLVLCDFED
SFYLDTQSEEIIQQMATENAKLGAKDTNLAAGIMQKSLVQQNSMSSFQNECHIPFPAEQH
PLGVTKIDHLDLKTVGTMKQSTDLHGVDILTPESPIFHSPILLEENGLFLKKNELSVTDS
QLNSFLQGYQTQETVKPVIPLIPQKRTPTGVEGECLPVPETSLNMSDSLLFDSFSDDYLV
KEQLPDVQMKGPLPSEVTSNHFSDSLCLQQEDLIKKSNVNENQDTCQQLTCSNDESIIFS
EMNSVQMVEALDNADIFRVQEKNHTVVSPRALELSDPVLDEHHQGDQDGGDQDERAEKSK
LTGTRQNHSFIWSGTSFDLSPGLQRFLDKVSSPLENEKLQSMTINLSSLNGKNTELNEQE
VISNLETKQVQGISFSSNNEVNSKIEMLENNANHDETSSLLPGKESDIVDDNGLIPPTPI
PTSASKLTFPGILETPVNLWKTNNVLQRGESYLFGSPSDIKNHDLSPESRNGFKDNSPIS
DTSFSLQLSQDGLQLTPASSSSESLAIIDVASDQNLFQTFIKEWRCKKRFSISLACEKIR
SLTSSKTATIGGRFKQASSPQEIPIRDDGFPIKGCDDILVVGLAVCWGGRDAYYFSLQKE
QKHSEISASLVPPSLDPSLTLKDRMWYLQSCLRKESDQECSVVIYDFIQSYKILLLSCGI
SLEQSYEDPKVACWLLDPDSQEPTLHSIVTSFLPHELPLLEGMETSQGIQSLGLNVGSEH
SGRYRASVESILIFNSMNQLNSLLQKENLQDVFRKVEMPSQYCLSLLELNGIGFSTAECE
SQKHIMQAKLDAIETQAYQLAGHSFSFTSSDDIAEVLFLELKLPPNGEMKNQGSKKTLGS
TRRGIDNGRKLRLGRQFSTSKDVLNKLKALHPLPGLILEWRRITNAITKVVFPLQREKRL
NPFLGMERIYPVSQSHTATGRITFTEPNIQNVPRDFEIKMPTLVGESPPSQAVGKGLLPM
GRGKYKKGCSLNPRCQAQMEERAADRGMPFSISMRHAFVPFPGGLILAADYSQLELRILA
HLSHDRRLIQVLNTGADVFRSIAAEWKMIEPESVGDDLRQQAKQICYGIIYGMGAKSLGE
QMGIKENDAACYIDSFKSRYTGINQFMTETVKNCKRDGFVQTILGRRRYLPGIKDNNPYR
KAHAERQAINTTVQGSAADIVKIATVNIQKQLETFHSTFKSHGHREGMLQSDRTGLSQKR
KLQGMFCPIRGGFFILQLHDELLYEVAEEDVVQVAQIVKNEMESAVKLSVKLKVKVKIGA
SWGELKDFDV
Download sequence
Identical sequences H2P9L4
9600.ENSPPYP00000015096 ENSPPYP00000015096 ENSPPYP00000015096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]