SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016479 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016479
Domain Number 1 Region: 2-542
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 5.49e-82
Family Acetyl-CoA synthetase-like 0.0000288
Further Details:      
 
Domain Number 2 Region: 755-1096
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.49e-49
Family Quinoprotein alcohol dehydrogenase-like 0.0085
Further Details:      
 
Domain Number 3 Region: 554-609
Classification Level Classification E-value
Superfamily ACP-like 0.0000419
Family Acyl-carrier protein (ACP) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016479   Gene: ENSPPYG00000014755   Transcript: ENSPPYT00000017152
Sequence length 1099
Comment pep:known_by_projection chromosome:PPYG2:4:63628850:63677639:1 gene:ENSPPYG00000014755 transcript:ENSPPYT00000017152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVDAASELSNFLLLHCDFQGIRE
IGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCNLKYILVEKKQINKFK
SFHETLLNYDTFTVEHNDLVLFRLHWKNTEVNLMLNDGKEKYEKEKIKISVSSEHVNEEK
AEEHMDLRLKHCLAYVLHTSGTTGIPKIVRVPHKCIVPNIQHFQVLFDITQEDVLFLASP
LTFDPSVVEIFLALSSGASLLIVPTSIKLLPSKLASVLFSHHRVTVLQATPTLLRRFGSQ
LIKSTVLSATTSLRVLALGGEAFPSLAVLRSWRGEGNKTQIFNVYGITEVSSWATIYRIP
EKTLNSTLKCELPVQLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGRNRVCFLDDEVTVP
LGTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIELVQQVAEELQQVESCAVTWYNQ
EKLILFMVSKDASVKEYIFKELQKYLPSHAVPDELVLIDSLPFTSHGKIDVSELNKIYLN
YINLKSENKLSGKEDLWEKLQYLWKSTLNLPEDLLRVPDESLFLNSGGDSLKSIRLLSEI
EKLVGTSLPGLLEIILSSSILEIYNHILQTVFPDEDVTFRKSCATKRKLSHINQEEASGT
SLHQKAIMTFSCHNEINAFVVLSRGSQILSLNTTRFLTKLGHCSSACPSDSISQTNIQNL
KGLNSPVIIGKSEDPSCVAKVSEDGKPVIGTQKMELHVRWRSDTGKCVDASPLVVIPTFD
KSSTTVYIGSHSHRIKAVDFYSGKVKWEQILGDRIESSACVSKCGNFIVVGCYNGLVYVL
KSNSGEKYWMFTTEDAVKSSATMDPTTGLIYIGSHDQHAYALDIYRKKCAWKSKCGGTVF
SSPCLNLIPHHLYFATLGGLLLAVNPATGNVIWKHSCGKPLFSSPRCCSQYICIGCVDGN
LLCFTHFGEQVWQFPTSGPIFSSPCTSPSEQKIFFGSHDCFIYCCNMKGHLQWKFETTSR
VYATPFAFHNYNGSNEMLLAAASTDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLI
IGCRDNYVYCLDLLGGNQK
Download sequence
Identical sequences H2PDD0
ENSPPYP00000016479 ENSPPYP00000016479 9600.ENSPPYP00000016479 XP_002814817.1.23681 XP_009238262.1.23681 XP_009238263.1.23681 XP_009238264.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]