SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021682 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021682
Domain Number 1 Region: 700-757
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.43e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-25
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 420-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 588-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-23
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 5 Region: 4-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 6 Region: 644-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.87e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 532-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.25e-23
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 8 Region: 367-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-21
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 9 Region: 756-811
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.89e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 10 Region: 327-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000162
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 211-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000147
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 12 Region: 259-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000364
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021682   Gene: ENSPPYG00000019350   Transcript: ENSPPYT00000022569
Sequence length 852
Comment pep:known_by_projection chromosome:PPYG2:9:83215335:83249774:-1 gene:ENSPPYG00000019350 transcript:ENSPPYT00000022569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKSLESVSFKDVTVDFSRDEWQQLDLAQKSLYREVMLENYFNLISVGCQVPKPEVIFSL
EQEEPCMLDGEIPSQSLPDGDIGFGPLQQRMSEEVSFQSEININLFTRDDPYSILEELWK
DDEHTRKCGEKQNKPLSHVAFINKKTLANDSIFEYKDIGEIVHVNTHLVSSRKRPHNCNS
CGKNLEPIVTLYNRNNATENSDKTIGDGDIFTHMNSHTEVTACECNQYGKPLHHKQALIQ
HQKIHTRDSLYLFSDYVNVFSLKSHAFAHESICAEEKQHECHECEAVFTRKSQLDGSQRV
YAGICTEYEKDFSLKSNHQKTPYEGNYYKCSDYGRAFIQKSDLFRCQRIHSGEKPYEYSE
CEKNLPQNSNLNIHKKIHTGGKHFECTECGKAFTRKSTLSMHQKIHTGEKPYVCTECGKA
FIRKSHFITHERIHTGEKPYECSDCGKSFIKKSQLHVHQRIHTGENPFICSECGKVFTHK
TNLIIHQKIHTGERPYICTVCGKAFTDRSNLIKHQKIHTGEKPYKCSDCGKSFTWKSRLR
IHQKCHTGERHYECSECGKAFIQKSTLSMHQRIHRGEKPYVCTECGKAFFHKSHFITHER
IHTGEKPYECSICGKSFTKKSQLHVHQQIHTGEKPYRCAECGKAFTDRSNLFTHQKIHTG
EKPYKCSDCGKAFTRKSGLHIHQQSHTGERHYECSECGKAFARKSTLIMHQRIHTGEKPY
ICTECGKSFIQKSHLNRHRRIHTGEKPYECSDCGKSFIKKSQLHEHHRIHTGEKPYICAE
CGKAFTIRSNLIKHQKIHTKQKPYKCSDLGKALNWKPQLSMPQKSDTGEVECSTPQLWCG
DSEGDQGQLSSI
Download sequence
Identical sequences H2PSL2
ENSPPYP00000021682 ENSPPYP00000021682 9600.ENSPPYP00000021682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]