SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022779 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022779
Domain Number 1 Region: 43-90,130-394,428-573
Classification Level Classification E-value
Superfamily Clc chloride channel 1.57e-127
Family Clc chloride channel 0.00011
Further Details:      
 
Domain Number 2 Region: 581-741
Classification Level Classification E-value
Superfamily CBS-domain pair 2.53e-32
Family CBS-domain pair 0.0000000523
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022779   Gene: ENSPPYG00000020349   Transcript: ENSPPYT00000023741
Sequence length 746
Comment pep:known chromosome:PPYG2:X:50589237:50615606:1 gene:ENSPPYG00000020349 transcript:ENSPPYT00000023741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLEEPIPGVGTYDDFNTIDWVREKSRDRDRHREITNKSKESTWALIHSVSDAFSGWLL
MLLIGLLSGSLAGLIDISAHWMTDLKEGICTGGFWFNHEHCCWNSEHVTFEERDKCPEWN
SWSQLIISTDEGAFAYIVNYFMYVLWALLFAFLAVSLVKVFAPYACGSGIPEIKTILSGF
IIRGYLGKWTLVIKTITLVLAVSSGLSLGKEGPLVHVACCCGNILCHCFNKYRKNEAKRR
EVLSAAAAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALVAAFTLRSINPFGN
SRLVLFYVEFHTPWHLFELVPFILLGIFGGLWGALFIRTNIAWCRKRKTTQLGKYPVIEV
LVVTAITAILAFPNEYTRMSTSELISELFNDCGLLDSSKLCDYENRFNTSKGGELPDRPA
GVGVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYH
QEWTVFNSWCSQGADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA
AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEFAHKTLAMDVMKPRRNDPLLTVLTQ
DSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSII
YFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLL
GIITKKDVLKHIAQMANQDPDSILFN
Download sequence
Identical sequences A0A2I3S544 A0A2J8S2N5 P51795 Q5RBK4
NP_000075.1.87134 NP_000075.1.92137 NP_001127343.1.23681 XP_003806007.1.60992 XP_016798938.1.37143 gi|4557473|ref|NP_000075.1| ENSP00000304257 ENSP00000365276 9600.ENSPPYP00000022779 ENSPPYP00000022779 ENSP00000304257 ENSP00000365276 ENSP00000469532 ENSP00000471330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]