SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024034 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024034
Domain Number 1 Region: 174-267
Classification Level Classification E-value
Superfamily TAFH domain-like 4.19e-36
Family TAFH domain-like 0.00000269
Further Details:      
 
Domain Number 2 Region: 461-508
Classification Level Classification E-value
Superfamily Histone-fold 2.47e-17
Family TBP-associated factors, TAFs 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024034   Gene: ENSPPYG00000029916   Transcript: ENSPPYT00000033298
Sequence length 674
Comment pep:known_by_projection chromosome:PPYG2:20:60230277:60318721:-1 gene:ENSPPYG00000029916 transcript:ENSPPYT00000033298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTPTATTSGIRTTQTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQ
ALAQMQAQAHAQPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQ
TTVQPSATLQRSPGVQPQLVLGGAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETME
NVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQP
YLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPPASQATTALTAVVLSSSVQRTAGKTAA
TVTSALQPPVLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQP
HNRIMLTTPQQIQLNPLQPVPVVKPAVLPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDD
DDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGI
TELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLD
QIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAA
IGPRKKRKVDCPGPGSGAEGSGPGSVVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENER
ETSHSLLLYKAFLK
Download sequence
Identical sequences K7EU11
ENSPPYP00000024034 ENSPPYP00000024034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]