SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|85059527|ref|YP_455229.1| from Sodalis glossinidius str. 'morsitans'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85059527|ref|YP_455229.1|
Domain Number 1 Region: 57-115
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000103
Family AraC type transcriptional activator 0.0003
Further Details:      
 
Domain Number 2 Region: 125-184
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.00000000000628
Family Rob transcription factor, C-terminal domain 0.00054
Further Details:      
 
Domain Number 3 Region: 6-55
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000806
Family AraC type transcriptional activator 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|85059527|ref|YP_455229.1|
Sequence length 201
Comment right origin-binding protein [Sodalis glossinidius str. 'morsitans']
Sequence
MDQAGIIQDLLSWLEGHLDTPLTLNRVAERSGYSKWHLQRKFKLATGQAIGAYIRARRLS
RAVLALRLTSRSVADIALQYGFDSQQTFTRPFKKQFIQTPALYRRSRKWHFLGMYPPYRF
DSRPLPQAEFVTLQVMTLIGTSQSYTCTLEQLSEYRTNLRSHFWRQFLAAMPTKPPVLYG
LSPHRRSRHEKIVRKCSIPQR
Download sequence
Identical sequences Q2NSQ1
343509.SG1549 gi|85059527|ref|YP_455229.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]