SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85057998|ref|YP_453700.1| from Sodalis glossinidius str. 'morsitans'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85057998|ref|YP_453700.1|
Domain Number 1 Region: 9-149
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.82e-34
Family MarR-like transcriptional regulators 0.0000898
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|85057998|ref|YP_453700.1|
Sequence length 152
Comment transcriptional regulator [Sodalis glossinidius str. 'morsitans']
Sequence
MNTSANNSQDDVLLLLDQQFCFSLYSANLALNKVYRKLLAKLDLTYPQYLVMLVLWERDA
VTVSDIGERLFLDSATLTPLLKRMESAGLLGRFRSADDERKVIIRLTDKGRSLRVLAATI
PADILCASSCSAEEFGALKRELETLRGHLAQW
Download sequence
Identical sequences Q2NX30
WP_011409885.1.28452 gi|85057998|ref|YP_453700.1| 343509.SG0020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]