SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85058803|ref|YP_454505.1| from Sodalis glossinidius str. 'morsitans'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85058803|ref|YP_454505.1|
Domain Number 1 Region: 9-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000016
Family Transcriptional regulator IclR, N-terminal domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|85058803|ref|YP_454505.1|
Sequence length 101
Comment hypothetical protein SG0825 [Sodalis glossinidius str. 'morsitans']
Sequence
MSKPNTSSSGTRILRVLKALRGHALNGVSNGELASALGESPANINRALNTLIEEGLALKL
DNGRFAPGVQLLQIAMAHSTEMARAQDRINEINQRVMAGSR
Download sequence
Identical sequences A0A0N8IUI6 A0A0P8ITK1 A0A1D3AEH7 A0A209ANF1 A0A223JQM0 A0A223UEW0 A0A235MRA2 A0A2G4QHG3 Q2NUS5 S1EQX3 S1HYL7
343509.SG0825 WP_000042842.1.100014 WP_000042842.1.100159 WP_000042842.1.101429 WP_000042842.1.101932 WP_000042842.1.11803 WP_000042842.1.12279 WP_000042842.1.14427 WP_000042842.1.14605 WP_000042842.1.17119 WP_000042842.1.17889 WP_000042842.1.19252 WP_000042842.1.22314 WP_000042842.1.22646 WP_000042842.1.22794 WP_000042842.1.2531 WP_000042842.1.26912 WP_000042842.1.2838 WP_000042842.1.28452 WP_000042842.1.30866 WP_000042842.1.34081 WP_000042842.1.36084 WP_000042842.1.40441 WP_000042842.1.43925 WP_000042842.1.4616 WP_000042842.1.46458 WP_000042842.1.46909 WP_000042842.1.4695 WP_000042842.1.47139 WP_000042842.1.51853 WP_000042842.1.51984 WP_000042842.1.53179 WP_000042842.1.57076 WP_000042842.1.58345 WP_000042842.1.58732 WP_000042842.1.60611 WP_000042842.1.61636 WP_000042842.1.68063 WP_000042842.1.68097 WP_000042842.1.69341 WP_000042842.1.70647 WP_000042842.1.72237 WP_000042842.1.73103 WP_000042842.1.74229 WP_000042842.1.75846 WP_000042842.1.76994 WP_000042842.1.7750 WP_000042842.1.78235 WP_000042842.1.79640 WP_000042842.1.79647 WP_000042842.1.8118 WP_000042842.1.81908 WP_000042842.1.83544 WP_000042842.1.84316 WP_000042842.1.85090 WP_000042842.1.86627 WP_000042842.1.8800 WP_000042842.1.88432 WP_000042842.1.91115 WP_000042842.1.94420 WP_000042842.1.97549 WP_000042842.1.98871 gi|85058803|ref|YP_454505.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]