SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|85059748|ref|YP_455450.1| from Sodalis glossinidius str. 'morsitans'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85059748|ref|YP_455450.1|
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.97e-36
Family Transcriptional regulator Rrf2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|85059748|ref|YP_455450.1|
Sequence length 165
Comment DNA-binding transcriptional regulator IscR [Sodalis glossinidius str. 'morsitans']
Sequence
MRLTSKGRYAVTAMLDVALHSGKGPVPLAEISERQGISLSYLEQLFSRLRKHELVASVRG
PGGGYLLGRDSDQIAVGAVITAVDESVDATRCQGKEGCQGGDRCLTHVLWRDLSVRISEF
LNNITLAELVSNEEILDVVDRQDNDTRRPLTNGRPQETINVNLHA
Download sequence
Identical sequences Q2NS30
343509.SG1770 gi|85059748|ref|YP_455450.1| WP_011411594.1.28452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]