SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85059944|ref|YP_455646.1| from Sodalis glossinidius str. 'morsitans'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85059944|ref|YP_455646.1|
Domain Number 1 Region: 22-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000118
Family MarR-like transcriptional regulators 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|85059944|ref|YP_455646.1|
Sequence length 143
Comment phage replication protein [Sodalis glossinidius str. 'morsitans']
Sequence
MSMSLIAKAMNIKVGNPIRKLVLLKLADNANDKGECWPSYQHIADHCECSKSTVRDHIDA
LEKAGLLVKENRTGTNNGKGNTFNVYHLKLDNPMPTPSTPPMPTGGTRISHSFEPVMEPK
TPYPLPGASPRNRQEKTKPPTKT
Download sequence
Identical sequences Q2NRI4
gi|85059944|ref|YP_455646.1| WP_011411696.1.28452 343509.SG1966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]