SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85060198|ref|YP_455900.1| from Sodalis glossinidius str. 'morsitans'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85060198|ref|YP_455900.1|
Domain Number 1 Region: 10-137
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7e-27
Family MarR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|85060198|ref|YP_455900.1|
Sequence length 141
Comment transcriptional regulator [Sodalis glossinidius str. 'morsitans']
Sequence
MDKSTDISVMVESLSRIYHRLRKEVNGQLVNEGLSMSKMKILHLITTGETSATDIKNYMG
FSSRTVVTVLDALEKEEMLQRQQSPTDRRVKYVYITEKGREKLRIAEQTHKVILDRMFAP
LSEMQLEKFSEVCNVLEAQQK
Download sequence
Identical sequences Q2NQT0
WP_011412031.1.28452 gi|85060198|ref|YP_455900.1| 343509.SG2220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]