SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000006815 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000006815
Domain Number 1 Region: 18-134
Classification Level Classification E-value
Superfamily Spectrin repeat 9.96e-23
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 2 Region: 381-463
Classification Level Classification E-value
Superfamily GAS2 domain-like 9.42e-22
Family GAS2 domain 0.0006
Further Details:      
 
Domain Number 3 Region: 292-372
Classification Level Classification E-value
Superfamily EF-hand 5.06e-17
Family Polcalcin 0.04
Further Details:      
 
Domain Number 4 Region: 144-216,246-276
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000394
Family Spectrin repeat 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000006815
Domain Number - Region: 1-26
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0912
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000006815   Gene: ENSOANG00000022542   Transcript: ENSOANT00000006817
Sequence length 689
Comment pep:known ultracontig:OANA5:Ultra546:1421482:1447147:-1 gene:ENSOANG00000022542 transcript:ENSOANT00000006817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQELSTRWETVCALSVSKQTRLEEALHQAEEFHSVVHVLLEWLAEAEQTLRFHGLLPDDE
EALRTLIDQHKEFMKKLEEKRAELNKATGMGEAVLAICHPDSITTIKHWITIIRARFEEV
LAWAKQHQQRLAGALAGLIAKQELLEALLTWLQWAETTLSDKDKETIPQEIEEVKALIAE
HQTFMEEMTRKQPDVDKVTKTYKRKAADPSPIQSHIPVLDKGRTGRKRSPSSAVYPSGSQ
TQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELKEFANFDFDIWRKKYMRWM
NHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDY
YEFVAALHPNKDAYKPLTDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGD
SQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRAKGRTNMELREKFILADGASQTMA
AFRPRGRRSRPSSRGASPNRSTSVSSQAGPVIPSQTIVTSTPKTSHHLTRNYGKPWLTNS
KTSTPSKPSESPDYQVSSAEGTPIQGSKLRLPGYLSGKGFHSGEDSGLITTAASRVRMQF
AESKRTPSRPGSRAGSKAGSRSSSRRGSDASDFDISEIQSVCSDMSETLPQANRPAPRAG
PRPATAKPSKIPTPQRRSPATKLDKSSKR
Download sequence
Identical sequences F6URM3
ENSOANP00000006815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]