SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000008875 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000008875
Domain Number 1 Region: 42-195
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.91e-29
Family Calponin-homology domain, CH-domain 0.0027
Further Details:      
 
Domain Number 2 Region: 213-291
Classification Level Classification E-value
Superfamily GAS2 domain-like 7.72e-28
Family GAS2 domain 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000008875   Gene: ENSOANG00000005582   Transcript: ENSOANT00000008877
Sequence length 709
Comment pep:known_by_projection ultracontig:OANA5:Ultra443:1311379:1327381:1 gene:ENSOANG00000005582 transcript:ENSOANT00000008877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNAVQVWFGEDLPLSPRSPLTPRHGPGLADVYQYDEWIAVRHEATLVPMQEDLSIWLTG
LLGVKVTTERLLEELDNGVLLCQLIEVLQKTVKVCCSSKELSDFPMKKVSCKKDASSGSF
FARDNTANFLHWCRCLGVDETYLFESEGLVLHKDPRQVYLCLLEIGRIVSRYGVEPPVLV
KLEKEIELEETLLNTSGPLIPINTPKTCCHHEELHEAVKHIAEDPPCSCSHRFSIEYLSE
GRYRLGDKILFIRMLHGKHVMVRVGGGWDTLQGFLLKYDPCRVLQFATLEQKILAFQKGI
SNESVPDSSVRPPQPPLMNPLSAVNMYQKQNFKPSTPVSAVRARVKQATSKHPQTSPKAV
MCPSSSLKSGQLNSGVGRSKLASSPATDSPLHHKTLKASSKKMDFPAKNVQSSVVAPRLA
HPVSKSTSSPTAVGPESLRKRILSPDNPRIRFSPSQNSSRGKPNAPLSPSSSKHSGKTET
TDSKHQNAIPTKCNLMSHSATHLNSSKSPSHTPNTNLHVGSRLPPSHQSLAKTAKSCSKS
TTKTVTGPQLSGRGPQAGLKQAQKVKSTQMLTPPASVSSASPAKAARLTPILESNRNNAA
STAKNKPQNKFKGLPVGSSSTKPIGRTPLSVVKLPQSSSKTQIIGKTTQPSPKSQSSVKA
PQKTGQIPASSEKKPLLANKETVSGAKKPIFKKEDDHYFVMIGSKKPRK
Download sequence
Identical sequences F6PYD0
XP_001506448.1.37387 ENSOANP00000008875 ENSOANP00000008875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]