SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000018649 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000018649
Domain Number 1 Region: 6-178
Classification Level Classification E-value
Superfamily CutC-like 1.44e-58
Family CutC-like 0.0000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000018649   Gene: ENSOANG00000011762   Transcript: ENSOANT00000018652
Sequence length 186
Comment pep:known_by_projection supercontig:OANA5:Contig26967:2748:13148:1 gene:ENSOANG00000011762 transcript:ENSOANT00000018652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGFLMEVCVDSVESAMNAERGGAGRLELCSSLLEGGTTPSMGVLQVVKQCVQIPVFVM
IRPRGGDFLYSDREVEVMKADIRLAKLHGADGLVLGALTEDGHIETELCMALLAVCRPLP
GHFPRTFDMVHDPVMALETLITLGFERVLTSGCDSSALEGLPLIKRLTEQVKPSFPLFPL
SSTSPM
Download sequence
Identical sequences F6T0N1
ENSOANP00000018649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]