SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000020461 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000020461
Domain Number 1 Region: 15-128
Classification Level Classification E-value
Superfamily dUTPase-like 1.57e-41
Family dUTPase-like 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000020461   Gene: ENSOANG00000012936   Transcript: ENSOANT00000020464
Sequence length 129
Comment pep:novel ultracontig:OANA5:Ultra375:30683:33282:1 gene:ENSOANG00000012936 transcript:ENSOANT00000020464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISAKHSFFILLAAFCSAYDYSIPAMEKALVKTDIQISLPSGCYGRVAPRSGLAAKHFID
VGAGVIDEDYRGNVGVILFNFGKEKFEVKKGDRIAQLICERVFYPELEEVQGLDDTERGS
GGFGSTGQN
Download sequence
Identical sequences F6ZCU3
XP_007667513.1.37387 ENSOANP00000000554 ENSOANP00000020461 ENSOANP00000000554 ENSOANP00000020461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]