SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000020742 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000020742
Domain Number 1 Region: 28-187
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.22e-30
Family Calponin-homology domain, CH-domain 0.0027
Further Details:      
 
Domain Number 2 Region: 203-282
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.67e-30
Family GAS2 domain 0.00000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000020742   Gene: ENSOANG00000013127   Transcript: ENSOANT00000020745
Sequence length 315
Comment pep:known_by_projection chromosome:OANA5:3:4452569:4563358:-1 gene:ENSOANG00000013127 transcript:ENSOANT00000020745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMCTALSPKVRGGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTHLLGREITAEAFME
KLDNGALLCRLAETLQEKFKDSIDANKLIKRLPVRKIPCRANAPSGSFFARDNTANFLSW
CRDVGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARFGVEPPGLIKLEKEIEQEETL
SAPPPSPSPSTMKSPGKKSTGKLLDDAVKHISEDPPCKCPNKFCVERLSQGRYRVGEKIL
FIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPIQNKSPTLKDLSPDN
YLVVSAHYKTKKEIK
Download sequence
Identical sequences F6T3L5
ENSOANP00000020742 9258.ENSOANP00000020742 ENSOANP00000020742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]