SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000005004 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000005004
Domain Number 1 Region: 427-551
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000137
Family Tropomyosin 0.0066
Further Details:      
 
Domain Number 2 Region: 546-728
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000562
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000005004   Gene: ENSOANG00000003157   Transcript: ENSOANT00000005005
Sequence length 944
Comment pep:known_by_projection supercontig:OANA5:Contig710:55300:385191:-1 gene:ENSOANG00000003157 transcript:ENSOANT00000005005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGSARSVSKVETGGQSPGRSPRLPRSPRLGHRRTNSTGGSGSGGPGGPGGGGAGGKTLS
MENIQSLNAAYATAGPMYLSDHENVGADTPKSTMTLGRSGGRLPYGVRMTAVGSSPNIAS
GEPAALGEHHLPPVSMASTVPHSLRQARDNTILDLQSQLKEVLRENDLLRKDVEVKESKL
SSSMNSIKTFWSPELKKERALRKDEASKITVWKEQYRVVQEENQHMQMTVQALQDELRIQ
RDLNQLFQQDGGGRAGGGEPLAAELTEENFQRLHGEHERQAKELFLLRKTLEEMELRIET
QKQTLNARDESIKKLLEMLQSKGLAAKASEEDHERTRRLAEAEMHVHHLEGLLDQKDKES
TMLREELHRRFENAPDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLKSNGALSTE
EREEEMKQMEVYRSHSKFMKNKVEQLKEELSTKEAQGEELKSRAAGLQTEIGQVKQELSR
KDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETM
LNKKTKQIQEMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSL
KERVKSLQADTTNTDTALTTLEEALAEKERTIERLKEQRDRDEREKQEEIDSYKKDLKDL
KEKVSLLQGDLSEKEASLLDLKEHASTLASAAVKKDSRLKALEIALEQKKEECLKMETQL
KKHPEALSSYPSAHEATVEARAGPEMTDRIQQLEKEVARHREEAGKAQAEVDRLLEILKE
MENEKNDKDKKIAELESLTSRQLKDQNKKVATLKHKEQVEKKKSAQMLEEARRREDNLND
SSQQLQDNLRKKDDRIEELEEALRESVQITAEREMVLAQEESARTNAEKQVEELMVAMEK
VRQELESMRSKLSSTQQSLAEKESHLTSLRAERRKHLEEVLEMK
Download sequence
Identical sequences F7AFV3
ENSOANP00000005004 ENSOANP00000005004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]