SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000009404 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000009404
Domain Number 1 Region: 536-804
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 7.27e-110
Family N-acetyl transferase, NAT 0.000000000732
Further Details:      
 
Domain Number 2 Region: 256-327
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.93e-17
Family PHD domain 0.0058
Further Details:      
 
Domain Number 3 Region: 101-180
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000163
Family Linker histone H1/H5 0.026
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000009404
Domain Number - Region: 884-919
Classification Level Classification E-value
Superfamily ARM repeat 0.000184
Family GUN4-associated domain 0.076
Further Details:      
 
Domain Number - Region: 201-270
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000753
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000009404   Gene: ENSOANG00000005908   Transcript: ENSOANT00000009406
Sequence length 1885
Comment pep:known_by_projection chromosome:OANA5:3:57632788:57843179:-1 gene:ENSOANG00000005908 transcript:ENSOANT00000009406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLANPLYTEWILEAIQKVKKQKQRPSEERICHAVCASHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSLVKPGTFPKSAKGARGSCNDLRNVDWNKLLRRAIEGLQE
PNGSSLKNIEKYLRSQSDLSSTTNNPVFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLE
GKGASKYSSAFPSSLPPVSLLPHERDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNAENMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRMLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPSRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLA
PDTEIKINIKQESADVNVVGSQDIVSEEDLDVFKQAQELSLEKIGCKSGVESNGRYPSVI
EFGKFEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIYR
RNDISVFEVDGNVSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLVGYF
SKEKLCQQKYNVSCIMIMPQYQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRLSYL
AYWKSVILEYLYHHHEKHISIKGISRATGMCPHDIATTLQHLSMIDKREEKFVIIRREKL
ISGHMEKLKTNARINELDPESLRWMPLLVSNAAVSEEELETEKEAEHLMEQGGSWEKEEP
EVVATRTNTKQSPAKVQSKXXXXXXLQLEEEEGGGGGVEEEEEEEEEEEEEEEEDEEEEE
DKEEEEEEEEEVEEEEEEEDHQPSSPPRLTKPQSLVVSRKRPFILKKKRGRKRRRINSSV
TTETISETTEVLNEPFENSDEERPMPQLEPTCEIEGEEDDLKPVIRKMFQYQPGKQRQEE
EEKEKDNHCYKNDEPGRKDNPEGANSLNDVTKDNPEPLRCKQGWPKGVKRGPSKWRQNKE
RKMGFKLNLYTPPETPMEPDCQVTVEEQKEASEEKPCQIPVVAEEAIKESSLPPVQPQDE
NGEEISAPPSPNKITFEKSENGVATKAEEEEEEEEEEEEEEEEEEEEEEEEREGDAESDN
TKSQEKDQPETCAEKKDPAAVDDHEEEEEEDEEPSHNEDHDADDEDDGHMDPAEAEKEEL
AGEAFKEALENQETFLDLSVQTGNSKPEELIDCGVDLSAPRTGESKEGAADAEDVPGPDE
EDVERRADRDRKDSEELNPEFKGEATETMELDSETAQAVQSLTQENGEQDDTFQDCSETQ
AACRSLQNYTRADQSPQISALDDCQQSDHSSPVSSVHSQPGQSARSVSSPTVPTLENGYA
QISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYD
STMGGSICGNNSSQNSCSFSSLTSSNLTQSSCAVTQQMSSINGSCSMMQQTGIGSPPTCN
VKSPQGCVAERPPSGSQQLPQCSMAANFTPPMQLAEIPETGGANVGLYERMGQGEFGPGH
YPQPSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANSASLPTPLSNAGLVQLSQSPHP
VPGGAQAQATMTPPPNLTPPPMNLPPPLLQRNMAASNIGLSHTQRLQTQIAGKGHVSMRT
KSAALPPAAAAAAAAAAAAHQSQIYGRASQAVAMQGPARTLTMQRGMNMSVNLMPAPAYN
VNSVNGYSMPQPMMNSGYHGNHGYMNQTPQYPMQMQMGMMGTQPYAQQPMQATPHSNMMY
TPPAHHGYMNTGMPKQSLNGSYMRR
Download sequence
Identical sequences F6QND8
ENSOANP00000009404 ENSOANP00000009404 9258.ENSOANP00000009404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]