SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000010961 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000010961
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 180-428
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-52
Family YWTD domain 0.00000317
Further Details:      
 
Domain Number 3 Region: 784-1044
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-40
Family YWTD domain 0.0000417
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-28
Family YWTD domain 0.0000436
Further Details:      
 
Domain Number 5 Region: 738-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000576
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 1174-1212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 1096-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 436-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000466
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 9 Region: 1136-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 132-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000305
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 11 Region: 1053-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000524
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000010961   Gene: ENSOANG00000006877   Transcript: ENSOANT00000010963
Sequence length 1462
Comment pep:novel ultracontig:OANA5:Ultra121:249829:315031:-1 gene:ENSOANG00000006877 transcript:ENSOANT00000010963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYWTDWGEVPKIERAGMDGSSRHVIINTDIYWPNGLTLDYKERKLYWADAKLNFIHKSNL
DGTDRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKYTGEGLREIHSNIFSPMDI
HAFSQKRQPNATNPCGTNNGGCSHLCLMAPSKPFYQCACATGVRLLEDGKTCKDGATELL
LLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFLDG
SGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTLRKILISEDLEEPRAI
VLDPTAGYMYWTDWGENPKIERAALDGSDRTVLVNTSLGWPNGLALDYDEGKIYWGDAKT
DKIEVMNADGSGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKQNAEREIIIDQ
LPDLMGLKATNVHRIIGSNPCAEENGGCSHLCLYRPQGLRCACPIGLELISDMKTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLD
TNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG
HLDYVMDILVFHSSRQAGWNECAASNGHCSHLCLAVPVGGFVCGCPAHYSLNPDNRTCRA
PTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNIIRK
AQEDGSQSLTVVVSSVPNQNLDMQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRPVGVV
LKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPVALALDS
QLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKID
MTGREGRTKVQARISQLSDIHAVKELNVQEYRHHPCSQDNGGCSHICIVKGDGTTRCSCP
VQLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDQSDELNCPVCSEA
EFQCSSGQCIDGSLRCNADANCQDKSDEKNCEVLCLMDQFRCANGQCIGKHKKCDHNMDC
SDKSDELDCYPTEEPAPQATNTVGSVIGVILTIFVFGAMYFICQRVLCPRMKGDGETMTN
DYVVHGSASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASSS
SSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTP
CSTDVCDSDYAPSRRVTAGAASKGYASDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSP
YTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences F7CQF2
ENSOANP00000010961 ENSOANP00000010961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]