SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000014794 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000014794
Domain Number 1 Region: 449-837
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.22e-130
Family Ankyrin repeat 0.000000000342
Further Details:      
 
Domain Number 2 Region: 108-464
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.36e-102
Family Ankyrin repeat 0.000000259
Further Details:      
 
Domain Number 3 Region: 3466-3580
Classification Level Classification E-value
Superfamily DEATH domain 5.72e-26
Family DEATH domain, DD 0.0082
Further Details:      
 
Domain Number 4 Region: 49-110
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000555
Family Ankyrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000014794   Gene: ENSOANG00000009296   Transcript: ENSOANT00000014797
Sequence length 3857
Comment pep:known_by_projection ultracontig:OANA5:Ultra445:3383530:3638407:1 gene:ENSOANG00000009296 transcript:ENSOANT00000014797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHAAASIKKVREAELEEREKNLERERKKQRKVPRERIERKRKSDSNASFLRAARAGNLD
KVVEFLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLERGSSVDSATKKQKGNTALHI
ASLAGQAEVVKVLVMEGASINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDG
FTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSK
MMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVK
LLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGD
HVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLH
IACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIR
GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHP
DAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLL
QRRASPDSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQ
IASTLLSYGAETDIVTKQGVTPLHLASQEGHTDMVTLLLEKGSNIHMTTKSGLTSLHLAA
QEDKVNVADILAKHGANQDAPTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYT
PLHQAAQQGHTHIINILLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTT
TTTVTEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSHFLDG
MNYLRYSLEGGRSDSLRSFSSDRSHTLSHASFLRESAMIEDTVMIPSNQVSSLAKEAERN
SYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTR
VTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGRERELVI
LRSENGDSWKEHYCDYTEDELNEILNGMDEAVLDSPEELEKKRICRIITRDFPQYFAVVS
RVKQDSNLIGPEGGVLSSTVAPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKAT
FSPIVTLEPRRRKFHKPITMTIPVPKASSDGLLNGFGGDTPTLRLLCSITGGTTPAQWED
ITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVSFASQVYREIICVPYMAKFVVFAK
SHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKS
GQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSSRGLIHQAICNLNITLPLY
TKESESDQEQEEEVDMTSEKHDDETESTETSVVKSHLVNEVPVLASPDLLSEVSEMKQDL
IKMTAILRTDASEKTDSIKGKEPVKAADEEPGEPFEIVERVKEDLEKVNEILRSGTCTGE
DSQMQRSPTGKEPVEEDWVIISDEEVQEAKQKAPSEVSEPPCVEIQINKETREETKKDPT
GLVNFLVEELNAYVTLPEMQPQSVQKDLAGEAFEAVVVSRRSEKEEPDARPGKTEDSKEP
PKPTLEIKKPVRRKLKEKQKQKEESVQESKEAAGLKKGSSEESLDEEKKLAPEAIPTARA
VSPLVEETPIGSIKDKVKALQKRVEDEQKGRSKLPVRVKGKDGTGQEPPKKPVHRTHPPA
SPSAKTDRRPPFSSSAKTERRSPVSPSVKTERHQPVSPSPKTDRRPPVSPSTKTEKHPVG
SPSAKSEKHPSGSPSARSEKHQPVSPAGKTERLEETMSVRELMKAFQSGQDPSKHKTGLF
EHKSAKPKQQPERGKVQVDKERGHAFTHREVHKSDSQTIRRGQRFPVAGASESRRGARAS
AGGPKREDAVGGKDKSLGLKVVEPPHPISKEESIPESGPAKGKEADEQGDLDLQISPDRK
TSTDFSEVIKEELEDNDRYQQFRQSEETEKAQLHLDQVLTSPFNVTFPADYVQDGFPPVL
ALQTRALEGSSESLKHEEVADSPCGSLMDGTPQISSEESYKHEGLAETPETSPESLSFSP
KKTEEKIDEIKGVAETPVAGERSSEKDGSDASEKPLAADTESAEPSATSLPEEETASADA
SSPKQEGENADCDGYVAAISKGPAEESTSGEDQRIESGSVSTADPDSGDRRSPAPELRDS
VEPADAPDPSGKEGGNTELEEQHVVIRSPQGLELSLPCHDNEGLSPVADESLAVSHKDSL
EASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMQVGILTGQVSLPPAPTKAE
MFAELASVRSRILRDPDGSAEDDSVEQTSLMESSGKSPLSPDTPSSEEVSYEITPKATDV
LVPKPAAIPECTEDEDSENGEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDCKKESRQ
DESPTEAELGADSPVETQESECTGGGEGVPVVVTSESRKASSSSESEPELKQLKKDADAC
LLMEPVIRVQPPSPLPTGVDSSSSPEETEFQPIVSRHYTFKMEEESQEEPSEPAVEKKGS
SSLSGDDPEGSTPASPVPLAEPSPGTEMEEAKPLYEATSPSDPAMSLDPRFCDASDDATE
GTLEACKDSILQEDTHPNDVDSTEGQKQEDPSPKAESPREYAHCLPSAPTCSASERQEPK
SSTPSPDKSSEMPVEGFVCEDAAAGSPEVPTVPQSDQLSTGISVPEDCPTDTAEVSTPQI
TSPYENVPTQAFFSYEETRTHNEVRQITSTFSSEVHSVTVESTVGQTLVTPSLGRSAPGD
DPDGYGERGSDRADSLGEGQTGQSFSSSLAESSAVAGGQVHTVIITKTDVDCDSWSAIRE
DDEAFEARVKEEEQKIFGLMVDRQSQGTTPDSTPARTPTEEGTPTSEQNPFLFQEGKLFE
MTRSGAIDMTKRSMADEGFHFFQIGQPSSQEVPSEEMKDGATQMDTPQVERPLEPPAPAE
SQEGEVHEADSLPEDSREDMEEMSATDAGDPKAELKSRIPIKMGVSASSKSSAGEATSPD
APEGESFSTVEAGDLPPNSDAPVPCPDSPEPVVEVQFNFSKVTRSVYSEQGDESPDSSPE
EPKSVIEIPASATESVPSTESKSKIPIRTTPAASQSLQPSESEPSLSEVSPDSPCGESKD
DEAKPKSKIPIKASFQRVEEQFTYTEVSVQKTESSLALDTSSQTPDNRSKSESDASRDFR
TKQAIKSRSFAEVEAETGQWPGEMQLELETDEGTMRPKMFSSRLPVKSRSISSSHSAISP
TNESKEHFFDLYKNSIEFFEEISDEASKLVDRLTQAEREQELVSDDESSSALEVSVIENV
PPVETEQALPEDIFDTRPIWDESVETLIERIPDETGPDPAEDPQDEQERTEERLAHIADH
LGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLTECLTK
INRMDIVHLMEANTAEPLQERANRSYAEIEQTIALDHSEGFSVLQEELCPPQQKKEGEHA
VSKESELSSEQPPIVSEEDISVGYSSFLDGLPKTEADVSVADFLQQPHPEQEPDEFSGKF
QDISKDSSPGYHQEYFVTTPGTEQPEASTAARESGSTPEEITPTAEEKERPFTPASSDQG
ESPIVQEPEDLQLQGEESSPRRSSLVIVESTDDQPQRSGHHDEADESFEKGDELPEIPPE
TVTEEEYTDEHGHTVVKKVTRKVIRRYISPEGTETEDITMFGSSQEPVTIEEGDGYSKVV
KRIVLKSDSERSEDINH
Download sequence
Identical sequences F7EIG5
ENSOANP00000014794 ENSOANP00000014794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]