SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000027411 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000027411
Domain Number 1 Region: 27-166
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 4.32e-25
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000027411   Gene: ENSOANG00000021526   Transcript: ENSOANT00000031211
Sequence length 166
Comment pep:novel supercontig:OANA5:Contig7058:14954:19177:1 gene:ENSOANG00000021526 transcript:ENSOANT00000031211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFIFSLLSTLSGLSWSQRLNYAHDFVEGNIYTYSCENMLLKGLPEWGLGRAGIKLNCK
VEISGTGPKFSLIRELSLLVTELYFPKIWPGDSFIPSPELIQSLVTQLLQPLKFRSRGWI
GSRYAPDSVSNAALNIYRGILNVLEITIERTETTYSLQEVNCQNVC
Download sequence
Identical sequences F6ZUB9
ENSOANP00000027411 9258.ENSOANP00000027411 ENSOANP00000027411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]