SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23097537|ref|NP_691003.1| from Oceanobacillus iheyensis HTE831

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23097537|ref|NP_691003.1|
Domain Number 1 Region: 2-241
Classification Level Classification E-value
Superfamily Hsp33 domain 8.11e-76
Family Hsp33 domain 0.000000089
Further Details:      
 
Domain Number 2 Region: 232-287
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 2.88e-20
Family HSP33 redox switch-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|23097537|ref|NP_691003.1|
Sequence length 289
Comment chaperonin [Oceanobacillus iheyensis HTE831]
Sequence
MKDYLIKATANNGKIRAYAVQSTNTIEEARRRQDTFATASAALGRTITITAMMGAMLKGD
DSITTKVMGNGPLGAIVADADADGHVRGYVTNPHVDFDLNDKGKLDVARAVGTEGNISVI
KDLGLKDFFTGETPIVSGEISEDFTYYYATSEQLPSAVGAGVLVNPDHTILAAGGFIVQV
MPGAEEEVINELEDQIQAIPAISSLIREGKSPEEILTQLFGEECLTIHEKMPIEFRCKCS
KDRLAQAIIGLGNDEIQAMIEEDQGAEATCHFCNEKYHFTEEELEDLKQ
Download sequence
Identical sequences Q8CXP5
WP_011064484.1.3139 221109.OB0082 gi|23097537|ref|NP_691003.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]