SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23098919|ref|NP_692385.1| from Oceanobacillus iheyensis HTE831

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23098919|ref|NP_692385.1|
Domain Number 1 Region: 200-620
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.56e-90
Family beta-Lactamase/D-ala carboxypeptidase 0.0000079
Further Details:      
 
Domain Number 2 Region: 55-248
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 5.76e-43
Family Penicillin binding protein dimerisation domain 0.0000393
Further Details:      
 
Domain Number 3 Region: 609-664
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000000916
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0016
Further Details:      
 
Domain Number 4 Region: 666-720
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000144
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|23098919|ref|NP_692385.1|
Sequence length 746
Comment penicillin-binding protein 2B [Oceanobacillus iheyensis HTE831]
Sequence
MKKHRTTHFMSSIYMIIFVALFLIITGRFMYIQATGEVSGVQLNEWADKQRTASYTMNSE
RGKIYDKNGMVLAYDRPTYRMYAILDEAYSENAEEPLHVSNAEETAKKLAPLLGVEEEEI
QEPIQNGLDNNRFQVEFGKFGKQISKQVKDEIEDLNIPGINFEEEPMRYYPNGMFASHII
GFAREEEKETDEGVEHTITGVTGMEDVMNDILGGKDGYISYQRDLYNKKLLDPSEVIQLP
EDGDDIYLTIDQKIQTLLEDVMTQADEKYNPTKMNAIIMDPKSGEIVAMSSRPSYDPNNP
TDVENWYNDPISTPFEPGSTMKIFTWAAAIEEGVYNGSEGFKSGTYQPNEKIRAIGDHNN
GEGWGTISYDEGFERSSNVAASKLLWEKLDSESYYEYLQAFGFEEPTGIDLPGEAVGKIS
YNWPSDKLRTAFGQSSTVTPIQQMKAASAIVNGGKMVKPYVVDKVVDSTSGDTISETEQE
YVGQPISEETAEQMKKLMSSVVNGEHGTGKPYQLEDYMVGGKTGTAEIPNPDGGGYLQGR
ENYVFSFMGMAPIDDPQLMVYVSIQQPELEPDESGSTPLSFIFKNVVENSLHYMDINPEK
NEAPDIQQMEMPDVVNKSTSEVEEEMTETGLNTIVVGEGSKVVSSSIEAGASVLPNEKVI
LITDEPTMPDIKGWSLREVMTLANLLDLQVESFGSGYVTTQNIDVGNPLQSGDYLGVELE
GPSSTDDEEESSEEENEEETGEDESE
Download sequence
Identical sequences Q8CXI7
221109.OB1464 WP_011065865.1.3139 gi|23098919|ref|NP_692385.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]