SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23098920|ref|NP_692386.1| from Oceanobacillus iheyensis HTE831

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23098920|ref|NP_692386.1|
Domain Number 1 Region: 172-571
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.15e-100
Family beta-Lactamase/D-ala carboxypeptidase 0.0000373
Further Details:      
 
Domain Number 2 Region: 52-220
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 7.85e-43
Family Penicillin binding protein dimerisation domain 0.002
Further Details:      
 
Domain Number 3 Region: 585-639
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000131
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|23098920|ref|NP_692386.1|
Sequence length 643
Comment stage V sporulation protein D [Oceanobacillus iheyensis HTE831]
Sequence
MKRVSTVTIKKRIVTVFLLGALIIAVIIGRLAYVQFVLGDDLAGQANELWTRDITFAAER
GYILDSEGEVLAENVTAPTVIVMPRQITNPEQTATQLAKILDVPQDRVHETITKNTSSVM
IRPEGIKITDKQEKAIRELDLSGVYLAKDSKRYYPNGDDLSHVLGFTGIDNQGLMGLELS
YDDKLKGENGSLSLYSDAKGRKLEELADEYNPPVDGLNLQTTINTKVQTIIERELDKATI
KYNPDGALAIAVNPKTGGILGMSSRPNFDPENYQDVDASIFGRNLPIWSTYEPGSTFKII
TLAAALEEGAVNLEEDRFHDDGDIEVGGATIHCWKKGGHGDQSYLEVVQNSCNPGFVNLG
QRLGTEKLFSYIDAFGFGKKTGIDLQGEGNGILFQPENVGPVELATTSFGQGVSVTPIQQ
VMAVAAAVNGGYLYKPYIADEWIDPVNGETVEKYEPQLQNRVISEDTSEEIRYALESVVA
QGTGRPAYVDGYRVGGKTGTAQKVGPNGGYMENNYIVSFIGFAPADDPEIVVYVAVDNPK
DTLQFGGVVAAPIVGTIIGDSLRAMEVEPTTDGLEKEYSWPDQPKVEVPDLIGESTQKLP
EYLVDLSVVTNGEGDTIIEQSPKPGTMLESGSTVRIYLSDENE
Download sequence
Identical sequences Q8CXI6
WP_011065866.1.3139 221109.OB1465 gi|23098920|ref|NP_692386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]