SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23098964|ref|NP_692430.1| from Oceanobacillus iheyensis HTE831

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23098964|ref|NP_692430.1|
Domain Number 1 Region: 8-268
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-83
Family Protein kinases, catalytic subunit 0.00000106
Further Details:      
 
Weak hits

Sequence:  gi|23098964|ref|NP_692430.1|
Domain Number - Region: 386-446
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000798
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0095
Further Details:      
 
Domain Number - Region: 526-582
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0111
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|23098964|ref|NP_692430.1|
Sequence length 688
Comment serine:threonine protein kinase [Oceanobacillus iheyensis HTE831]
Sequence
MNKGELLNERYKIIKKIGGGGMANVYLARDTILERDVAVKALRMEYIHDQEFIARFDREA
QSATSLSHPNIVNIFDVGEEDQLLYMVMEYVDGMTLKEYIHQHGPIDVPEALDIMKQLTS
AIAHAHANEIVHRDIKPQNILINSTGQAKVTDFGIAMALSATALTQTNSILGSVHYLSPE
QARGGMATKKSDIYSMGIVLYELLTGKLPFSGQSPVSIALKHLQNNTPSVKKANPSIPQS
VENIVLQATAKDPFHRYNNIYELEEALETALDPNRLDEEPFSLPEEVGDETKAIPIITDQ
DNVVDNNNEDTIIHATNQGTKNYPEEPHAKDNKKKKKGKVKKEQKKSKNKKPKSKKKKVF
WIVFSILLLALLVTGITVFATQPKDIPMPDVIEMDSADAKQTLEESNLEVEEEEVFSDEI
ENGLVVRTDPNAGRTVKEGSTVTMFVSQGQERVEMEDYEGQDFEQVKELLEEEGFTDITS
YEKSSEAPVGEIISQIQPEAGSEVVPGETKVIFEISSGPELVSLNNLTGMSKEEVQDYID
RNELTMNSHEEYSDNVDEGRVIRQEPPSGTDLEKGSTVDVYFSMGPEEIPPRSHTVSFTV
NYEPQEEEGSENEDGNEEEQQPVEQIVRVYIGDVNNEISDVYEERAITEDEEFTFTLMVP
PDSEAEYKVTRDDEVIKERSVSYEGEED
Download sequence
Identical sequences Q8ER22
221109.OB1509 WP_011065910.1.3139 gi|23098964|ref|NP_692430.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]