SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23099086|ref|NP_692552.1| from Oceanobacillus iheyensis HTE831

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23099086|ref|NP_692552.1|
Domain Number 1 Region: 257-558
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 5.75e-89
Family DNA repair protein MutS, domain III 0.00000166
Further Details:      
 
Domain Number 2 Region: 559-790
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.03e-61
Family ABC transporter ATPase domain-like 0.000000702
Further Details:      
 
Domain Number 3 Region: 2-110
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 3.14e-43
Family DNA repair protein MutS, domain I 0.000013
Further Details:      
 
Domain Number 4 Region: 114-270
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 1.14e-27
Family DNA repair protein MutS, domain II 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|23099086|ref|NP_692552.1|
Sequence length 867
Comment DNA mismatch repair protein MutS [Oceanobacillus iheyensis HTE831]
Sequence
MAKLTPMMEQYIQIKNEYKDAFLFYRLGDFYELFYEDATRAAQELEITLTKRAGGKGDPI
PMCGVPYHSAENYIKTLIDRGYKVAICEQVEDPKTAKGVVKREVVQMITPGTVMESTMLT
DGENNYIGSLSHFQDGSYVIVYNDLSTGENRLAFINDGWDAVIHEFYNQPIKEIVISSNL
PEELQIQLKERLNVTLSYQDEVTFNAEFRELSENLNDERLMKAFSRLLNYIQTTQKRSLH
HLQKAEVIELKKYMSLDMYSKRNLELTETIMKKSKHGSLLWVLDKTVTAMGARTLKKWLE
RPLLSKQKINERLEVVQGFYDGFMERESLRDLLKSVYDLERLSGRIAFGNVNARDLIQLK
QSLSRIPAIQETLRQFDQPEITRLAEMLIYPEQMVESLEKSIVDEPPISIKEGSLIKEGY
HDQLDTYRDASRNGKKWIAQLEHQEREETGIRSLKVGYNRVFGYYIEITKPNLHLLPEGR
YERRQTLTNAERFVNEELKEKEKLILEAEEKSVELEYDLFIQIRDQIKEEIPLIQQLAHI
ISQMDVLQSFATVSESNNYVRPDFNDEQLQVTKGRHPVVEQVMKDGTFVPNDVVFDKSQN
MLLITGPNMSGKSTYMRQVALTSIMGQIGCFIPAEQATLCVFDQIFTRIGAADDLVSGQS
TFMVEMLEARHAISNATDRSLILLDEIGRGTSTYDGMALAQAIVEYIHHNIAAKTLFSTH
YHELTALEDSLHHLKNIHVRAEEHEGNVVFLHQIKEGAADQSYGIHVAKLADLPNELIER
ASVILEELEDDSNKKPTPTKDKLESGQLSFFIEESNKKKAEMPKQEKTHNNQEQSVIEDL
KNVNVLDLTPLEAMNELYRLQKGLKQY
Download sequence
Identical sequences Q8CXG6
WP_011066031.1.3139 221109.OB1631 gi|23099086|ref|NP_692552.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]