SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23099109|ref|NP_692575.1| from Oceanobacillus iheyensis HTE831

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23099109|ref|NP_692575.1|
Domain Number 1 Region: 146-343
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 8.64e-58
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000751
Further Details:      
 
Domain Number 2 Region: 427-559
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-34
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000084
Further Details:      
 
Domain Number 3 Region: 13-145
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.49e-33
Family Duplicated SiR/NiR-like domains 1 and 3 0.0033
Further Details:      
 
Domain Number 4 Region: 345-419
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.47e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|23099109|ref|NP_692575.1|
Sequence length 576
Comment sulfite reductase subunit beta [Oceanobacillus iheyensis HTE831]
Sequence
MTKSNISKDNGPLDEVEGIKERSNFLRGTIAEGLEDRITGAISDEDNKLLKFHGSYQQDD
RDLRDERRRKKLEPAYQFMIRVRTPGGVTTPEQWLVMDDLAHKYANGSMRLTTRQTFQLH
GIVKWDLKKTMQGMNQALMTTIAACGDINRNVMCNVNPEQSDVHAEVYEWSKKVSDHLLP
ETNAYHEIWLEDKKIVDSREESEPIYGSTYLPRKFKIGIAVPPSNDIDIYSQDLGFIAIV
EEGKLLGFNVAVGGGMGMTHGDTNTYPQISRVIGFCVPEKVTEVAEKVVTIQRDFGNRSN
RKNARFKYTIDSRGIDWFIDELNERLGWELEGKRHYEFDSNGDSYGWIEGKDYWHLTLFI
QNGRIKDVEDYPLMTGLREIAKVHTGDFRLTPNQNLIIANVSSDNKKQINDLVEKFNLTE
GKTYSGLRRNSMACVAFPTCGLAMAESERYLPELLDKIEVILDESGLREEEIVIRMSGCP
NGCSRPALAEIAFIGKAPGKYNMYLGGSFNGSRLNKLYKENIGEEEILNTLRPIFIDFAK
DKQKDEHFGDFVIRAGYVEEVKSGLDFHSSKEDVRS
Download sequence
Identical sequences Q8EQP0
gi|23099109|ref|NP_692575.1| 221109.OB1654 WP_011066055.1.3139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]